Human PLA2G10(Phospholipase A2, Group X) ELISA Kit

To Order Contact us: michael@lotusbiotechnologies.com

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx252990-96tests	Abbexa	96 tests	801.6 EUR

Human PLA2G10(Phospholipase A2, Group X) ELISA Kit
EH3603	FN Test	96T	628.92 EUR

Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 4.688pg/ml
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
SED833Hu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	5677.8 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
SED833Hu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	572.76 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
SED833Hu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	766.8 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
SED833Hu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	3090.6 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
4-SED833Hu	Cloud-Clone	5738.40 EUR 3031.20 EUR 768.00 EUR	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells

Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group X (PLA2G10) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species.
Human Phospholipase A2, Group X(PLA2G10)ELISA Kit
QY-E05176	Qayee Biotechnology	96T	433.2 EUR
Phospholipase A2, Group X (PLA2G10) Antibody
20-abx126373	Abbexa	493.20 EUR 710.40 EUR 218.40 EUR 376.80 EUR	100 ul 200 ul 20 ul 50 ul

Phospholipase A2, Group X (PLA2G10) Antibody
20-abx128169	Abbexa	510.00 EUR 159.60 EUR 1446.00 EUR 693.60 EUR 393.60 EUR	100 ug 10 ug 1 mg 200 ug 50 ug

Phospholipase A2, Group X (PLA2G10) Antibody
20-abx301835	Abbexa	493.20 EUR 2214.00 EUR 718.80 EUR 218.40 EUR 360.00 EUR	100 ug 1 mg 200 ug 20 ug 50 ug

Phospholipase A2, Group X (PLA2G10) Antibody
20-abx174048	Abbexa	1028.40 EUR 526.80 EUR	1 mg 200 ug

Recombinant Phospholipase A2, Group X (PLA2G10)
4-RPD833Hu01	Cloud-Clone	601.69 EUR 284.40 EUR 1926.34 EUR 722.11 EUR 1324.22 EUR 477.60 EUR 4635.84 EUR	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg

Description: Recombinant Human Phospholipase A2, Group X expressed in: E.coli
Human Phospholipase A2, Group X (PLA2G10) Protein
20-abx167064	Abbexa	844.80 EUR 343.20 EUR 2598.00 EUR 994.80 EUR 594.00 EUR	100 ug 10 ug 1 mg 200 ug 50 ug

Monkey Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx360270-96tests	Abbexa	96 tests	990 EUR

Pig Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx362012-96tests	Abbexa	96 tests	990 EUR

Rabbit Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx362347-96tests	Abbexa	96 tests	990 EUR

Chicken Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx356098-96tests	Abbexa	96 tests	990 EUR

Human Phospholipase A2, Group X (PLA2G10) CLIA Kit
abx197460-96tests	Abbexa	96 tests	990 EUR

Human Phospholipase A2, Group X (PLA2G10) CLIA Kit
20-abx494408	Abbexa	9567.60 EUR 5095.20 EUR 1177.20 EUR	10 × 96 tests 5 × 96 tests 96 tests

ELISA kit for Human PLA2G10 (Phospholipase A2, Group X)
E-EL-H1011	Elabscience Biotech	1 plate of 96 wells	640.8 EUR

Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G10 (Phospholipase A2, Group X) in samples from Serum, Plasma, Cell supernatant
ELISA kit for Human PLA2G10 (Phospholipase A2, Group X)
ELK4236	ELK Biotech	1 plate of 96 wells	518.4 EUR

Description: A sandwich ELISA kit for detection of Phospholipase A2, Group X from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.
Phospholipase A2, Group X (PLA2G10) Antibody (HRP)
20-abx315919	Abbexa	493.20 EUR 2214.00 EUR 718.80 EUR 218.40 EUR 360.00 EUR	100 ug 1 mg 200 ug 20 ug 50 ug

Phospholipase A2, Group X (PLA2G10) Antibody (FITC)
20-abx315920	Abbexa	493.20 EUR 2214.00 EUR 718.80 EUR 218.40 EUR 360.00 EUR	100 ug 1 mg 200 ug 20 ug 50 ug

Phospholipase A2, Group X (PLA2G10) Antibody (Biotin)
20-abx315921	Abbexa	493.20 EUR 2214.00 EUR 718.80 EUR 218.40 EUR 360.00 EUR	100 ug 1 mg 200 ug 20 ug 50 ug

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human)
4-PAD833Hu01	Cloud-Clone	296.40 EUR 3012.00 EUR 750.00 EUR 372.00 EUR 256.80 EUR	100ul 10ml 1ml 200ul 20ul

Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10)
CLIA kit for Human PLA2G10 (Phospholipase A2, Group X)
E-CL-H0681	Elabscience Biotech	1 plate of 96 wells	700.8 EUR

Description: A sandwich CLIA kit for quantitative measurement of Human PLA2G10 (Phospholipase A2, Group X) in samples from Serum, Plasma, Cell supernatant
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), APC
4-PAD833Hu01-APC	Cloud-Clone	414.00 EUR 3930.00 EUR 1094.40 EUR 528.00 EUR 262.80 EUR	100ul 10ml 1ml 200ul 20ul

Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with APC.
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), Biotinylated
4-PAD833Hu01-Biotin	Cloud-Clone	373.20 EUR 2952.00 EUR 872.40 EUR 457.20 EUR 262.80 EUR	100ul 10ml 1ml 200ul 20ul

Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with Biotin.
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), Cy3
4-PAD833Hu01-Cy3	Cloud-Clone	502.80 EUR 5190.00 EUR 1410.00 EUR 654.00 EUR 301.20 EUR	100ul 10ml 1ml 200ul 20ul

Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with Cy3.
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), FITC
4-PAD833Hu01-FITC	Cloud-Clone	355.20 EUR 3168.00 EUR 900.00 EUR 446.40 EUR 234.00 EUR	100ul 10ml 1ml 200ul 20ul

Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with FITC.
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), HRP
4-PAD833Hu01-HRP	Cloud-Clone	379.20 EUR 3426.00 EUR 968.40 EUR 477.60 EUR 247.20 EUR	100ul 10ml 1ml 200ul 20ul

Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with HRP.
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), PE
4-PAD833Hu01-PE	Cloud-Clone	355.20 EUR 3168.00 EUR 900.00 EUR 446.40 EUR 234.00 EUR	100ul 10ml 1ml 200ul 20ul

Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with PE.
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), APC-Cy7
4-PAD833Hu01-APC-Cy7	Cloud-Clone	685.20 EUR 7716.00 EUR 2046.00 EUR 912.00 EUR 382.80 EUR	100ul 10ml 1ml 200ul 20ul

Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with APC-Cy7.
Human Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
CSB-EL018085HU-24T	Cusabio	1 plate of 24 wells	198 EUR

Description: Quantitativesandwich ELISA kit for measuring Human Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Human Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
1-CSB-EL018085HU	Cusabio	964.80 EUR 6118.80 EUR 3244.80 EUR	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each

Description: Quantitativesandwich ELISA kit for measuring Human Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Human Group 10 secretory phospholipase A2, PLA2G10 ELISA KIT
ELI-37033h	Lifescience Market	96 Tests	988.8 EUR
Mouse Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
CSB-EL018085MO-24T	Cusabio	1 plate of 24 wells	198 EUR

Description: Quantitativesandwich ELISA kit for measuring Mouse Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Mouse Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
1-CSB-EL018085MO	Cusabio	964.80 EUR 6118.80 EUR 3244.80 EUR	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each

Description: Quantitativesandwich ELISA kit for measuring Mouse Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Rat Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
CSB-EL018085RA-24T	Cusabio	1 plate of 24 wells	198 EUR

Description: Quantitativesandwich ELISA kit for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Rat Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
1-CSB-EL018085RA	Cusabio	964.80 EUR 6118.80 EUR 3244.80 EUR	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each

Description: Quantitativesandwich ELISA kit for measuring Rat Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Mouse Group 10 secretory phospholipase A2, Pla2g10 ELISA KIT
ELI-16162m	Lifescience Market	96 Tests	1038 EUR
PLA2G10 Secreted Phospholipase A2-X Human Recombinant Protein
PROTO15496	BosterBio	Regular: 10ug	380.4 EUR
Description: Secreted Phospholipase A2-X Human Recombinant is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag (underlined).;MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQ;PRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQE;LLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD.
ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10)
KTE100470-48T	Abbkine	48T	398.4 EUR

Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10)
KTE100470-5platesof96wells	Abbkine	5 plates of 96 wells	2538 EUR

Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10)
KTE100470-96T	Abbkine	96T	646.8 EUR

Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
Human Phospholipase A2, Group IID (PLA2G2D)ELISA kit
201-12-2525	SunredBio	96 tests	528 EUR

Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.
Human Phospholipase A2, Group IIA (PLA2G2A)ELISA kit
201-12-2527	SunredBio	96 tests	528 EUR

Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.
Human Phospholipase A2, Group IVD (PLA2G4D)ELISA kit
201-12-2529	SunredBio	96 tests	528 EUR

Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.
Human Phospholipase A2, Group XIIB (PLA2G12B)ELISA kit
201-12-2530	SunredBio	96 tests	528 EUR

Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
20-abx152759	Abbexa	8853.60 EUR 4719.60 EUR 1093.20 EUR	10 × 96 tests 5 × 96 tests 96 tests

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
20-abx152760	Abbexa	8853.60 EUR 4719.60 EUR 1093.20 EUR	10 × 96 tests 5 × 96 tests 96 tests

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
20-abx152761	Abbexa	8534.40 EUR 4550.40 EUR 1054.80 EUR	10 × 96 tests 5 × 96 tests 96 tests

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
20-abx152762	Abbexa	8853.60 EUR 4719.60 EUR 1093.20 EUR	10 × 96 tests 5 × 96 tests 96 tests

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
20-abx152763	Abbexa	8853.60 EUR 4719.60 EUR 1093.20 EUR	10 × 96 tests 5 × 96 tests 96 tests

Human Phospholipase A2 Group VI (PLA2G6) ELISA Kit
abx253845-96tests	Abbexa	96 tests	801.6 EUR

Human Group IIA phospholipase A2 (PLA2G2A) ELISA Kit
abx575929-96tests	Abbexa	96 tests	886.8 EUR

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
DLR-PLA2G12B-Hu-48T	DL Develop	48T	664.8 EUR

Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from serum, plasma, tissue homogenates or other biological fluids.
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
DLR-PLA2G12B-Hu-96T	DL Develop	96T	870 EUR

Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from serum, plasma, tissue homogenates or other biological fluids.
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
DLR-PLA2G2A-Hu-48T	DL Develop	48T	620.4 EUR

Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
DLR-PLA2G2A-Hu-96T	DL Develop	96T	807.6 EUR

Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
DLR-PLA2G2D-Hu-48T	DL Develop	48T	597.6 EUR

Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids.
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
DLR-PLA2G2D-Hu-96T	DL Develop	96T	776.4 EUR

Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids.
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit
DLR-PLA2G3-Hu-48T	DL Develop	48T	620.4 EUR

Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids.
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit
DLR-PLA2G3-Hu-96T	DL Develop	96T	807.6 EUR

Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids.
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
DLR-PLA2G4D-Hu-48T	DL Develop	48T	664.8 EUR

Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from tissue homogenates or other biological fluids.
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
DLR-PLA2G4D-Hu-96T	DL Develop	96T	870 EUR

Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from tissue homogenates or other biological fluids.
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
DLR-PLA2G5-Hu-48T	DL Develop	48T	620.4 EUR

Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates or other biological fluids.
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
DLR-PLA2G5-Hu-96T	DL Develop	96T	807.6 EUR

Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates or other biological fluids.
Human Group XVI phospholipase A2, PLA2G16 ELISA KIT
ELI-45167h	Lifescience Market	96 Tests	988.8 EUR
Human Group XV phospholipase A2, PLA2G15 ELISA KIT
ELI-21820h	Lifescience Market	96 Tests	988.8 EUR
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Hu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	5677.8 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Hu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	572.76 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Hu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	766.8 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Hu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	3090.6 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
4-SED827Hu	Cloud-Clone	5738.40 EUR 3031.20 EUR 768.00 EUR	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells

Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
SED832Hu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	5677.8 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
SED832Hu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	572.76 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
SED832Hu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	766.8 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
SED832Hu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	3090.6 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
4-SED832Hu	Cloud-Clone	5738.40 EUR 3031.20 EUR 768.00 EUR	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells

Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
SEM563Hu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	6227.58 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids.
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
SEM563Hu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	618.04 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids.
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
SEM563Hu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	831.48 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids.
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
SEM563Hu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	3381.66 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids.
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
4-SEM563Hu	Cloud-Clone	6288.00 EUR 3322.80 EUR 831.60 EUR	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells

Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
SEN729Hu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	6227.58 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
SEN729Hu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	618.04 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
SEN729Hu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	831.48 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
SEN729Hu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	3381.66 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
4-SEN729Hu	Cloud-Clone	6288.00 EUR 3322.80 EUR 831.60 EUR	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells

Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from Serum, plasma, tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
RD-PLA2G12B-Hu-48Tests	Reddot Biotech	48 Tests	675.6 EUR
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
RD-PLA2G12B-Hu-96Tests	Reddot Biotech	96 Tests	939.6 EUR
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RD-PLA2G2A-Hu-48Tests	Reddot Biotech	48 Tests	625.2 EUR
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RD-PLA2G2A-Hu-96Tests	Reddot Biotech	96 Tests	867.6 EUR
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
RD-PLA2G2D-Hu-48Tests	Reddot Biotech	48 Tests	600 EUR
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
RD-PLA2G2D-Hu-96Tests	Reddot Biotech	96 Tests	830.4 EUR
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit
RD-PLA2G3-Hu-48Tests	Reddot Biotech	48 Tests	625.2 EUR
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit
RD-PLA2G3-Hu-96Tests	Reddot Biotech	96 Tests	867.6 EUR
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
RD-PLA2G4D-Hu-48Tests	Reddot Biotech	48 Tests	675.6 EUR
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
RD-PLA2G4D-Hu-96Tests	Reddot Biotech	96 Tests	939.6 EUR
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
RD-PLA2G5-Hu-48Tests	Reddot Biotech	48 Tests	625.2 EUR
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
RD-PLA2G5-Hu-96Tests	Reddot Biotech	96 Tests	867.6 EUR
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
RDR-PLA2G12B-Hu-48Tests	Reddot Biotech	48 Tests	706.8 EUR
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
RDR-PLA2G12B-Hu-96Tests	Reddot Biotech	96 Tests	984 EUR
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RDR-PLA2G2A-Hu-48Tests	Reddot Biotech	48 Tests	652.8 EUR
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RDR-PLA2G2A-Hu-96Tests	Reddot Biotech	96 Tests	907.2 EUR
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
RDR-PLA2G2D-Hu-48Tests	Reddot Biotech	48 Tests	626.4 EUR
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
RDR-PLA2G2D-Hu-96Tests	Reddot Biotech	96 Tests	868.8 EUR
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit
RDR-PLA2G3-Hu-48Tests	Reddot Biotech	48 Tests	652.8 EUR
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit
RDR-PLA2G3-Hu-96Tests	Reddot Biotech	96 Tests	907.2 EUR
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
RDR-PLA2G4D-Hu-48Tests	Reddot Biotech	48 Tests	706.8 EUR
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
RDR-PLA2G4D-Hu-96Tests	Reddot Biotech	96 Tests	984 EUR
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
RDR-PLA2G5-Hu-48Tests	Reddot Biotech	48 Tests	652.8 EUR
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
RDR-PLA2G5-Hu-96Tests	Reddot Biotech	96 Tests	907.2 EUR
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
SEB077Hu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	5402.92 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
SEB077Hu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	550.13 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
SEB077Hu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	734.46 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
SEB077Hu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	2945.08 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
4-SEB077Hu	Cloud-Clone	5463.60 EUR 2886.00 EUR 735.60 EUR	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells

Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.
Human Phospholipase A2, Group XIIB(PLA2G12B)ELISA Kit
QY-E05175	Qayee Biotechnology	96T	433.2 EUR
Human Phospholipase A2, Group IVD(PLA2G4D)ELISA Kit
QY-E05205	Qayee Biotechnology	96T	433.2 EUR
Human Phospholipase A2, Group IID(PLA2G2D)ELISA Kit
QY-E05226	Qayee Biotechnology	96T	433.2 EUR
Human Phospholipase A2, Group IIA(PLA2G2A)ELISA Kit
QY-E05227	Qayee Biotechnology	96T	433.2 EUR
Human Phospholipase A2, Group IIA ELISA Kit (PLA2G2A)
RK02095	Abclonal	96 Tests	625.2 EUR
Human Phospholipase A2, Group IID ELISA Kit (PLA2G2D)
RK02096	Abclonal	96 Tests	625.2 EUR
Human Phospholipase A2, Group V ELISA Kit (PLA2G5)
RK02097	Abclonal	96 Tests	625.2 EUR
Phospholipase A2, Group Ive Antibody
20-abx114482	Abbexa	878.40 EUR 477.60 EUR	150 ul 50 ul

Phospholipase A2, Group Ivf Antibody
20-abx114483	Abbexa	878.40 EUR 477.60 EUR	150 ul 50 ul

Phospholipase A2, Group Xiia Antibody
20-abx114484	Abbexa	878.40 EUR 477.60 EUR	150 ul 50 ul

Phospholipase A2, Group Xiib Antibody
20-abx114485	Abbexa	878.40 EUR 477.60 EUR	150 ul 50 ul

Human Phospholipase A2 Group XII A (PLA2G12A) ELISA Kit
abx382266-96tests	Abbexa	96 tests	1093.2 EUR

Human Phospholipase A2 Group IV B (PLA2G4B) ELISA Kit
abx382267-96tests	Abbexa	96 tests	1093.2 EUR

Human Phospholipase A2 Group IV E (PLA2G4E) ELISA Kit
abx382268-96tests	Abbexa	96 tests	1093.2 EUR

Human Phospholipase A2 Group IV F (PLA2G4E) ELISA Kit
20-abx382269	Abbexa	8853.60 EUR 4719.60 EUR 1093.20 EUR	10 × 96 tests 5 × 96 tests 96 tests

Human Phospholipase A2, Group II A (PLA2G2A) ELISA Kit
abx251779-96tests	Abbexa	96 tests	904.8 EUR

Human Phospholipase A2, Group XII B (PLA2G12B) ELISA Kit
abx252991-96tests	Abbexa	96 tests	848.4 EUR

Human Phospholipase A2, Group IV D (PLA2G4D) ELISA Kit
abx252993-96tests	Abbexa	96 tests	848.4 EUR

Human Phospholipase A2, Group II D (PLA2G2D) ELISA Kit
abx354458-96tests	Abbexa	96 tests	848.4 EUR

Human Group XIIA secretory phospholipase A2(PLA2G12A) ELISA kit
CSB-EL018086HU-24T	Cusabio	1 plate of 24 wells	198 EUR

Description: Quantitativecompetitive ELISA kit for measuring Human Group XIIA secretory phospholipase A2 (PLA2G12A) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Human Group XIIA secretory phospholipase A2(PLA2G12A) ELISA kit
1-CSB-EL018086HU	Cusabio	964.80 EUR 6118.80 EUR 3244.80 EUR	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each

Description: Quantitativecompetitive ELISA kit for measuring Human Group XIIA secretory phospholipase A2(PLA2G12A) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Human Group IIF secretory phospholipase A2(PLA2G2F) ELISA kit
CSB-EL018095HU-24T	Cusabio	1 plate of 24 wells	198 EUR

Description: Quantitativesandwich ELISA kit for measuring Human Group IIF secretory phospholipase A2 (PLA2G2F) in samples from serum, plasma, tissue, homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Human Group IIF secretory phospholipase A2(PLA2G2F) ELISA kit
1-CSB-EL018095HU	Cusabio	964.80 EUR 6118.80 EUR 3244.80 EUR	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each

Description: Quantitativesandwich ELISA kit for measuring Human Group IIF secretory phospholipase A2(PLA2G2F) in samples from serum, plasma, tissue, homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
ELISA kit for Human PLA2G12B (Phospholipase A2, Group ? B)
E-EL-H1029	Elabscience Biotech	1 plate of 96 wells	640.8 EUR

Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G12B (Phospholipase A2, Group ? B) in samples from Serum, Plasma, Cell supernatant
ELISA kit for Human PLA2G4D (Phospholipase A2, Group ? D)
E-EL-H1048	Elabscience Biotech	1 plate of 96 wells	640.8 EUR

Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G4D (Phospholipase A2, Group ? D) in samples from Serum, Plasma, Cell supernatant
ELISA kit for Human PLA2G2D (Phospholipase A2, Group IID)
ELK1754	ELK Biotech	1 plate of 96 wells	518.4 EUR

Description: A sandwich ELISA kit for detection of Phospholipase A2, Group IID from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.
ELISA kit for Human PLA2G2A (Phospholipase A2, Group IIA)
ELK3752	ELK Biotech	1 plate of 96 wells	518.4 EUR

Description: A sandwich ELISA kit for detection of Phospholipase A2, Group IIA from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.
Human PLA2G12B(Phospholipase A2, Group XII B) ELISA Kit
EH3604	FN Test	96T	628.92 EUR

Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.094 ng/ml
Human PLA2G4D(Phospholipase A2, Group IV D) ELISA Kit
EH3606	FN Test	96T	628.92 EUR

Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.094 ng/ml
ELISA kit for Human PLA2G12B (Phospholipase A2, Group XIIB)
ELK6117	ELK Biotech	1 plate of 96 wells	518.4 EUR

Description: A sandwich ELISA kit for detection of Phospholipase A2, Group XIIB from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.
ELISA kit for Human PLA2G4D (Phospholipase A2, Group IVD)
ELK6188	ELK Biotech	1 plate of 96 wells	518.4 EUR

Description: A sandwich ELISA kit for detection of Phospholipase A2, Group IVD from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.
ELISA kit for Human PLA2G5 (Phospholipase A2, Group V)
ELK4777	ELK Biotech	1 plate of 96 wells	518.4 EUR

Description: A sandwich ELISA kit for detection of Phospholipase A2, Group V from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.
Human Group IIF secretory phospholipase A2, PLA2G2F ELISA KIT
ELI-23295h	Lifescience Market	96 Tests	988.8 EUR
Human Group IID secretory phospholipase A2, PLA2G2D ELISA KIT
ELI-45186h	Lifescience Market	96 Tests	988.8 EUR
Human Group IIE secretory phospholipase A2, PLA2G2E ELISA KIT
ELI-35519h	Lifescience Market	96 Tests	988.8 EUR
Human Group XIIA secretory phospholipase A2, PLA2G12A ELISA KIT
ELI-21567h	Lifescience Market	96 Tests	988.8 EUR
Human Group 3 secretory phospholipase A2, PLA2G3 ELISA KIT
ELI-37656h	Lifescience Market	96 Tests	988.8 EUR
ELISA kit for Human PLA2G2D (Phospholipase A2, Group ?D)
E-EL-H2384	Elabscience Biotech	1 plate of 96 wells	640.8 EUR

Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G2D (Phospholipase A2, Group ?D) in samples from Serum, Plasma, Cell supernatant
ELISA kit for Human PLA2G2A (Phospholipase A2, Group ?A)
E-EL-H2385	Elabscience Biotech	1 plate of 96 wells	640.8 EUR

Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G2A (Phospholipase A2, Group ?A) in samples from Serum, Plasma, Cell supernatant
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
20-abx154554	Abbexa	8853.60 EUR 4719.60 EUR 1093.20 EUR	10 × 96 tests 5 × 96 tests 96 tests

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
20-abx154555	Abbexa	8684.40 EUR 4626.00 EUR 1074.00 EUR	10 × 96 tests 5 × 96 tests 96 tests

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
20-abx154556	Abbexa	8853.60 EUR 4719.60 EUR 1093.20 EUR	10 × 96 tests 5 × 96 tests 96 tests

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
20-abx155982	Abbexa	8684.40 EUR 4626.00 EUR 1074.00 EUR	10 × 96 tests 5 × 96 tests 96 tests

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
abx254356-96tests	Abbexa	96 tests	848.4 EUR

Mouse Phospholipase A2 Group VI (PLA2G6) ELISA Kit
abx512875-96tests	Abbexa	96 tests	801.6 EUR

Rat Phospholipase A2 Group VI (PLA2G6) ELISA Kit
abx512877-96tests	Abbexa	96 tests	801.6 EUR

Cow Group IIA phospholipase A2 (PLA2G2A) ELISA Kit
abx520902-96tests	Abbexa	96 tests	1093.2 EUR

Rat Group IIA phospholipase A2 (PLA2G2A) ELISA Kit
abx572864-96tests	Abbexa	96 tests	848.4 EUR

Mouse Group IIA phospholipase A2 (PLA2G2A) ELISA Kit
abx575023-96tests	Abbexa	96 tests	886.8 EUR

Rat Group IIA phospholipase A2 (PLA2G2A) ELISA Kit
abx255942-96tests	Abbexa	96 tests	848.4 EUR

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
DLR-PLA2G2A-Mu-48T	DL Develop	48T	632.4 EUR

Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
DLR-PLA2G2A-Mu-96T	DL Develop	96T	825.6 EUR

Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
DLR-PLA2G2A-Ra-48T	DL Develop	48T	658.8 EUR

Description: A sandwich quantitative ELISA assay kit for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
DLR-PLA2G2A-Ra-96T	DL Develop	96T	861.6 EUR

Description: A sandwich quantitative ELISA assay kit for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
DLR-PLA2G2D-Mu-48T	DL Develop	48T	609.6 EUR

Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids.
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
DLR-PLA2G2D-Mu-96T	DL Develop	96T	793.2 EUR

Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids.
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
DLR-PLA2G3-Mu-48T	DL Develop	48T	632.4 EUR

Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids.
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
DLR-PLA2G3-Mu-96T	DL Develop	96T	825.6 EUR

Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids.
Rat PLA2G2A(Phospholipase A2,Group IIA) ELISA Kit
ER1276	FN Test	96T	628.92 EUR

Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Rattus;Sensitivity: 0.094 ng/ml
Mouse PLA2G2D(Phospholipase A2, Group IID) ELISA Kit
EM1297	FN Test	96T	628.92 EUR

Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 18.75pg/ml
Mouse Group XVI phospholipase A2, Pla2g16 ELISA KIT
ELI-37775m	Lifescience Market	96 Tests	1038 EUR
Bovine Group XV phospholipase A2, PLA2G15 ELISA KIT
ELI-14523b	Lifescience Market	96 Tests	1113.6 EUR
Mouse Group XV phospholipase A2, Pla2g15 ELISA KIT
ELI-14703m	Lifescience Market	96 Tests	1038 EUR
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Mu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	5834.88 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Mu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	585.7 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Mu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	785.28 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Mu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	3173.76 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
4-SED827Mu	Cloud-Clone	5895.60 EUR 3114.00 EUR 786.00 EUR	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells

Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Ra-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	6149.04 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Ra-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	611.57 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Ra-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	822.24 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Ra-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	3340.08 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
4-SED827Ra	Cloud-Clone	6210.00 EUR 3280.80 EUR 823.20 EUR	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells

Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in samples from Serum, plasma, tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
SED831Mu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	5834.88 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group III (PLA2G3) in serum, plasma and other biological fluids.
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
SED831Mu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	585.7 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group III (PLA2G3) in serum, plasma and other biological fluids.
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
SED831Mu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	785.28 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group III (PLA2G3) in serum, plasma and other biological fluids.
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
SED831Mu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	3173.76 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group III (PLA2G3) in serum, plasma and other biological fluids.
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
4-SED831Mu	Cloud-Clone	5895.60 EUR 3114.00 EUR 786.00 EUR	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells

Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Phospholipase A2, Group III (PLA2G3) in samples from Serum, plasma and other biological fluids. with no significant corss-reactivity with analogues from other species.
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RD-PLA2G2A-Mu-48Tests	Reddot Biotech	48 Tests	639.6 EUR
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RD-PLA2G2A-Mu-96Tests	Reddot Biotech	96 Tests	888 EUR
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RD-PLA2G2A-Ra-48Tests	Reddot Biotech	48 Tests	668.4 EUR
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RD-PLA2G2A-Ra-96Tests	Reddot Biotech	96 Tests	930 EUR
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
RD-PLA2G2D-Mu-48Tests	Reddot Biotech	48 Tests	613.2 EUR
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
RD-PLA2G2D-Mu-96Tests	Reddot Biotech	96 Tests	850.8 EUR
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
RD-PLA2G3-Mu-48Tests	Reddot Biotech	48 Tests	639.6 EUR
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
RD-PLA2G3-Mu-96Tests	Reddot Biotech	96 Tests	888 EUR
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RDR-PLA2G2A-Mu-48Tests	Reddot Biotech	48 Tests	668.4 EUR
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RDR-PLA2G2A-Mu-96Tests	Reddot Biotech	96 Tests	928.8 EUR
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RDR-PLA2G2A-Ra-48Tests	Reddot Biotech	48 Tests	699.6 EUR
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RDR-PLA2G2A-Ra-96Tests	Reddot Biotech	96 Tests	973.2 EUR
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
RDR-PLA2G2D-Mu-48Tests	Reddot Biotech	48 Tests	640.8 EUR
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
RDR-PLA2G2D-Mu-96Tests	Reddot Biotech	96 Tests	890.4 EUR
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
RDR-PLA2G3-Mu-48Tests	Reddot Biotech	48 Tests	668.4 EUR
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
RDR-PLA2G3-Mu-96Tests	Reddot Biotech	96 Tests	928.8 EUR
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
SEB077Mu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	5552.14 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
SEB077Mu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	562.42 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
SEB077Mu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	752.02 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
SEB077Mu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	3024.07 EUR

Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
4-SEB077Mu	Cloud-Clone	5612.40 EUR 2965.20 EUR 752.40 EUR	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells

Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in samples from Serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.
Rat Phospholipase A2, Group IIA(PLA2G2A)ELISA Kit
QY-E10194	Qayee Biotechnology	96T	433.2 EUR
Rat Phospholipase A2(Group IVD(PLA2G4D)ELISA kit
QY-E10542	Qayee Biotechnology	96T	495.6 EUR
Rat Phospholipase A2(Group IID(PLA2G2D)ELISA kit
QY-E10543	Qayee Biotechnology	96T	495.6 EUR
Mouse Phospholipase A2(Group IID(PLA2G2D)ELISA kit
QY-E21172	Qayee Biotechnology	96T	433.2 EUR
Mouse Phospholipase A2(Group IVD(PLA2G4D)ELISA kit
QY-E21173	Qayee Biotechnology	96T	433.2 EUR
Mouse Phospholipase A2, Group IIA(PLA2G2A)ELISA Kit
QY-E21175	Qayee Biotechnology	96T	433.2 EUR
Recombinant Human Secreted Phospholipase A2-X
7-03355	CHI Scientific	2µg	Ask for price
Recombinant Human Secreted Phospholipase A2-X
7-03356	CHI Scientific	10µg	Ask for price
Recombinant Human Secreted Phospholipase A2-X
7-03357	CHI Scientific	1mg	Ask for price
Human Phospholipase A2, Group IVD (PLA2G4D) CLIA Kit
20-abx496066	Abbexa	10282.80 EUR 5472.00 EUR 1262.40 EUR	10 × 96 tests 5 × 96 tests 96 tests

Human Phospholipase A2, Group XIIB (PLA2G12B) CLIA Kit
20-abx496107	Abbexa	10282.80 EUR 5472.00 EUR 1262.40 EUR	10 × 96 tests 5 × 96 tests 96 tests

Human Phospholipase A2, Group IIA (PLA2G2A) CLIA Kit
20-abx494403	Abbexa	9567.60 EUR 5095.20 EUR 1177.20 EUR	10 × 96 tests 5 × 96 tests 96 tests

Human Phospholipase A2, Group V (PLA2G5) CLIA Kit
20-abx494407	Abbexa	9567.60 EUR 5095.20 EUR 1177.20 EUR	10 × 96 tests 5 × 96 tests 96 tests

Human Phospholipase A2, Group IID (PLA2G2D) CLIA Kit
20-abx492390	Abbexa	9567.60 EUR 5095.20 EUR 1177.20 EUR	10 × 96 tests 5 × 96 tests 96 tests

Secreted Phospholipase A2-X (Recombinant)
20-abx073638	Abbexa	393.60 EUR 6373.20 EUR 276.00 EUR	10 ug 1 mg 2 µg

Human Phospholipase A2, Group IIA (PLA2G2A) Protein
20-abx166841	Abbexa	811.20 EUR 343.20 EUR 2498.40 EUR 961.20 EUR 577.20 EUR	100 ug 10 ug 1 mg 200 ug 50 ug

Human Phospholipase A2, Group III (PLA2G3) Protein
20-abx650483	Abbexa	844.80 EUR 343.20 EUR 2598.00 EUR 994.80 EUR 594.00 EUR	100 ug 10 ug 1 mg 200 ug 50 ug

Human Phospholipase A2, Group XII (PLA2G12) Protein
20-abx650485	Abbexa	844.80 EUR 343.20 EUR 2631.60 EUR 1011.60 EUR 610.80 EUR	100 ug 10 ug 1 mg 200 ug 50 ug

Human Phospholipase A2, Group IVD (PLA2G4D) Protein
20-abx650806	Abbexa	777.60 EUR 326.40 EUR 2331.60 EUR 910.80 EUR 560.40 EUR	100 ug 10 ug 1 mg 200 ug 50 ug

Human Phospholipase A2, Group IID (PLA2G2D) Protein
20-abx654724	Abbexa	693.60 EUR 309.60 EUR 2064.00 EUR 828.00 EUR 510.00 EUR	100 ug 10 ug 1 mg 200 ug 50 ug

Human Phospholipase A2, Group V (PLA2G5) Protein
20-abx654728	Abbexa	693.60 EUR 309.60 EUR 2064.00 EUR 828.00 EUR 510.00 EUR	100 ug 10 ug 1 mg 200 ug 50 ug

Human Phospholipase A2, Group XIIB (PLA2G12B) Protein
20-abx654729	Abbexa	693.60 EUR 309.60 EUR 2064.00 EUR 828.00 EUR 510.00 EUR	100 ug 10 ug 1 mg 200 ug 50 ug

Human Group IID secretory phospholipase A2 (PLA2G2D)
1-CSB-EP891566HU	Cusabio	456.00 EUR 256.80 EUR 1570.80 EUR 672.00 EUR 1047.60 EUR 314.40 EUR	100ug 10ug 1MG 200ug 500ug 50ug

Description: Recombinant Human Group IID secretory phospholipase A2(PLA2G2D),partial expressed in E.coli
Human Group XIIA secretory phospholipase A2 (PLA2G12A)
1-CSB-YP863638HU	Cusabio	516.00 EUR 280.80 EUR 1809.60 EUR 770.40 EUR 1210.80 EUR 349.20 EUR	100ug 10ug 1MG 200ug 500ug 50ug

Description: Recombinant Human Group XIIA secretory phospholipase A2(PLA2G12A),partial expressed in Yeast
Phospholipase A2 Group IVC (PLA2G4C) Antibody
20-abx134069	Abbexa	360.00 EUR 526.80 EUR 226.80 EUR	100 ul 200 ul 30 ul

Phospholipase A2, Group IIA (PLA2G2A) Antibody
20-abx103197	Abbexa	543.60 EUR 159.60 EUR 1562.40 EUR 744.00 EUR 410.40 EUR	100 ug 10 ug 1 mg 200 ug 50 ug

Phospholipase A2, Group IID (PLA2G2D) Antibody
20-abx103198	Abbexa	360.00 EUR 159.60 EUR 961.20 EUR 510.00 EUR 309.60 EUR	100 ug 10 ug 1 mg 200 ug 50 ug

Phospholipase A2 Group IVC (PLA2G4C) Antibody
20-abx006526	Abbexa	493.20 EUR 710.40 EUR 218.40 EUR 376.80 EUR	100 ul 200 ul 20 ul 50 ul

Phospholipase A2 Group VI (PLA2G6) Antibody
20-abx124080	Abbexa	493.20 EUR 710.40 EUR 218.40 EUR 376.80 EUR	100 ul 200 ul 20 ul 50 ul

Phospholipase A2, Group IID (PLA2G2D) Antibody
20-abx130118	Abbexa	526.80 EUR 159.60 EUR 1479.60 EUR 710.40 EUR 393.60 EUR	100 ug 10 ug 1 mg 200 ug 50 ug

Phospholipase A2, Group IVD (PLA2G4D) Antibody
20-abx130913	Abbexa	543.60 EUR 159.60 EUR 1579.20 EUR 744.00 EUR 410.40 EUR	100 ug 10 ug 1 mg 200 ug 50 ug

Phospholipase A2, Group III (PLA2G3) Antibody
20-abx131085	Abbexa	393.60 EUR 159.60 EUR 1045.20 EUR 543.60 EUR 326.40 EUR	100 ug 10 ug 1 mg 200 ug 50 ug

Phospholipase A2, Group III (PLA2G3) Antibody
20-abx131086	Abbexa	510.00 EUR 159.60 EUR 1446.00 EUR 693.60 EUR 393.60 EUR	100 ug 10 ug 1 mg 200 ug 50 ug

Phospholipase A2, Group XII (PLA2G12) Antibody
20-abx131471	Abbexa	526.80 EUR 159.60 EUR 1479.60 EUR 710.40 EUR 393.60 EUR	100 ug 10 ug 1 mg 200 ug 50 ug

Phospholipase A2, Group XII (PLA2G12) Antibody
20-abx131472	Abbexa	510.00 EUR 159.60 EUR 1446.00 EUR 693.60 EUR 393.60 EUR	100 ug 10 ug 1 mg 200 ug 50 ug

Phospholipase A2, Group IIA (PLA2G2A) Antibody
20-abx128864	Abbexa	510.00 EUR 159.60 EUR 1446.00 EUR 693.60 EUR 393.60 EUR	100 ug 10 ug 1 mg 200 ug 50 ug

Phospholipase A2, Group Ivd (Cytosolic) Antibody
20-abx114481	Abbexa	878.40 EUR 477.60 EUR	150 ul 50 ul

Phospholipase A2 Group IVC (PLA2G4C) Antibody
20-abx014417	Abbexa	376.80 EUR 117.60 EUR 477.60 EUR 594.00 EUR	100 ug 10 ug 200 ug 300 µg

Phospholipase A2, Group V (PLA2G5) Antibody
abx028287-400ul	Abbexa	400 ul	627.6 EUR

Phospholipase A2, Group V (PLA2G5) Antibody
abx028287-80l	Abbexa	80 µl	343.2 EUR

Phospholipase A2, Group III (PLA2G3) Antibody
abx030609-400ul	Abbexa	400 ul	627.6 EUR

Phospholipase A2, Group III (PLA2G3) Antibody
abx030609-80l	Abbexa	80 µl	343.2 EUR

Phospholipase A2 Group IVC (PLA2G4C) Antibody
20-abx321000	Abbexa	526.80 EUR 393.60 EUR	100 ul 50 ul

Phospholipase A2 Group IVC (PLA2G4C) Antibody
20-abx322485	Abbexa	526.80 EUR 393.60 EUR	100 ul 50 ul

Phospholipase A2, Group IVD (PLA2G4D) Antibody
20-abx323008	Abbexa	376.80 EUR 292.80 EUR	100 ug 50 ug

Phospholipase A2 Group IVC (PLA2G4C) Antibody
abx331099-100ul	Abbexa	100 ul	510 EUR

Phospholipase A2 Group IVC (PLA2G4C) Antibody
20-abx323686	Abbexa	376.80 EUR 292.80 EUR	100 ug 50 ug

Phospholipase A2 Group VI (PLA2G6) Antibody
20-abx327999	Abbexa	376.80 EUR 292.80 EUR	100 ug 50 ug

Phospholipase A2 Group IVC (PLA2G4C) Antibody
abx433141-200ul	Abbexa	200 ul	460.8 EUR

Phospholipase A2, Group IIA (PLA2G2A) Antibody
20-abx174043	Abbexa	1028.40 EUR 526.80 EUR	1 mg 200 ug

Phospholipase A2, Group IIA (PLA2G2A) Antibody
20-abx174044	Abbexa	1095.60 EUR 560.40 EUR	1 mg 200 ug