April 12, 2021

Human PLA2G10(Phospholipase A2, Group X) ELISA Kit

Human PLA2G10(Phospholipase A2, Group X) ELISA Kit

To Order Contact us: michael@lotusbiotechnologies.com

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
RD-PLA2G10-Hu-48Tests 48 Tests
EUR 521
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
RD-PLA2G10-Hu-96Tests 96 Tests
EUR 723
Human Phospholipase A2, Group X (PLA2G10)ELISA kit
201-12-2526 96 tests
EUR 440
  • This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx252990-96tests 96 tests
EUR 668
  • Shipped within 5-12 working days.
Human PLA2G10(Phospholipase A2, Group X) ELISA Kit
EH3603 96T
EUR 524.1
  • Detection range: 7.813-500 pg/ml
  • Uniprot ID: O15496
  • Alias: PLA2G10
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 4.688pg/ml
Human Phospholipase A2, Group X(PLA2G10)ELISA Kit
QY-E05176 96T
EUR 361
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
SED833Hu-10x96wellstestplate 10x96-wells test plate
EUR 4731.5
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group X (PLA2G10) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay:
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
SED833Hu-1x48wellstestplate 1x48-wells test plate
EUR 477.3
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group X (PLA2G10) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay:
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
SED833Hu-1x96wellstestplate 1x96-wells test plate
EUR 639
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group X (PLA2G10) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay:
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
SED833Hu-5x96wellstestplate 5x96-wells test plate
EUR 2575.5
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group X (PLA2G10) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay:
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
  • EUR 4782.00
  • EUR 2526.00
  • EUR 640.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Phospholipase A2, Group X elisa. Alternative names of the recognized antigen: GXPLA2
  • GX sPLA2
  • sPLA2-X
  • Group 10 secretory phospholipase A2
  • Phosphatidylcholine 2-acylhydrolase 10
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group X (PLA2G10) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species.
Phospholipase A2, Group X (PLA2G10) Antibody
  • EUR 411.00
  • EUR 592.00
  • EUR 182.00
  • EUR 314.00
  • 100 ul
  • 200 ul
  • 20 ul
  • 50 ul
  • Shipped within 5-10 working days.
Phospholipase A2, Group X (PLA2G10) Antibody
  • EUR 425.00
  • EUR 133.00
  • EUR 1205.00
  • EUR 578.00
  • EUR 328.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Phospholipase A2, Group X (PLA2G10) Antibody
  • EUR 857.00
  • EUR 439.00
  • 1 mg
  • 200 ug
  • Please enquire.
Phospholipase A2, Group X (PLA2G10) Antibody
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.
Recombinant Phospholipase A2, Group X (PLA2G10)
  • EUR 501.41
  • EUR 237.00
  • EUR 1605.28
  • EUR 601.76
  • EUR 1103.52
  • EUR 398.00
  • EUR 3863.20
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: O15496
  • Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 18.7KDa
  • Isoelectric Point: Inquire
Description: Recombinant Human Phospholipase A2, Group X expressed in: E.coli
Human Phospholipase A2, Group X (PLA2G10) Protein
  • EUR 704.00
  • EUR 286.00
  • EUR 2165.00
  • EUR 829.00
  • EUR 495.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Monkey Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx360270-96tests 96 tests
EUR 825
  • Shipped within 5-12 working days.
Pig Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx362012-96tests 96 tests
EUR 825
  • Shipped within 5-12 working days.
Rabbit Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx362347-96tests 96 tests
EUR 825
  • Shipped within 5-12 working days.
Chicken Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx356098-96tests 96 tests
EUR 825
  • Shipped within 5-12 working days.
Human Phospholipase A2, Group X (PLA2G10) CLIA Kit
abx197460-96tests 96 tests
EUR 825
  • Shipped within 5-12 working days.
Human Phospholipase A2, Group X (PLA2G10) CLIA Kit
  • EUR 7973.00
  • EUR 4246.00
  • EUR 981.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Please enquire.
ELISA kit for Human PLA2G10 (Phospholipase A2, Group X)
E-EL-H1011 1 plate of 96 wells
EUR 534
  • Gentaur's PLA2G10 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human PLA2G10. Standards or samples are added to the micro ELISA plate wells and combined w
  • Show more
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G10 (Phospholipase A2, Group X) in samples from Serum, Plasma, Cell supernatant
ELISA kit for Human PLA2G10 (Phospholipase A2, Group X)
ELK4236 1 plate of 96 wells
EUR 432
  • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Phospholipase A2, Group X (PLA2G10). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific t
  • Show more
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group X from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.
Phospholipase A2, Group X (PLA2G10) Antibody (HRP)
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.
Phospholipase A2, Group X (PLA2G10) Antibody (FITC)
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.
Phospholipase A2, Group X (PLA2G10) Antibody (Biotin)
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human)
  • EUR 247.00
  • EUR 2510.00
  • EUR 625.00
  • EUR 310.00
  • EUR 214.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: PLA2G10 (Glu32~Asp165)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10)
CLIA kit for Human PLA2G10 (Phospholipase A2, Group X)
E-CL-H0681 1 plate of 96 wells
EUR 584
  • Gentaur's PLA2G10 CLIA kit utilizes the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Human PLA2G10 . Standards or samples are added to the micro CLIA plate wells and combined wit
  • Show more
Description: A sandwich CLIA kit for quantitative measurement of Human PLA2G10 (Phospholipase A2, Group X) in samples from Serum, Plasma, Cell supernatant
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), APC
  • EUR 345.00
  • EUR 3275.00
  • EUR 912.00
  • EUR 440.00
  • EUR 219.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: PLA2G10 (Glu32~Asp165)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with APC.
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), Biotinylated
  • EUR 311.00
  • EUR 2460.00
  • EUR 727.00
  • EUR 381.00
  • EUR 219.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: PLA2G10 (Glu32~Asp165)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with Biotin.
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), Cy3
  • EUR 419.00
  • EUR 4325.00
  • EUR 1175.00
  • EUR 545.00
  • EUR 251.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: PLA2G10 (Glu32~Asp165)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with Cy3.
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), FITC
  • EUR 296.00
  • EUR 2640.00
  • EUR 750.00
  • EUR 372.00
  • EUR 195.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: PLA2G10 (Glu32~Asp165)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with FITC.
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), HRP
  • EUR 316.00
  • EUR 2855.00
  • EUR 807.00
  • EUR 398.00
  • EUR 206.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: PLA2G10 (Glu32~Asp165)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with HRP.
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), PE
  • EUR 296.00
  • EUR 2640.00
  • EUR 750.00
  • EUR 372.00
  • EUR 195.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: PLA2G10 (Glu32~Asp165)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with PE.
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), APC-Cy7
  • EUR 571.00
  • EUR 6430.00
  • EUR 1705.00
  • EUR 760.00
  • EUR 319.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: PLA2G10 (Glu32~Asp165)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with APC-Cy7.
Human Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
CSB-EL018085HU-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Human Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Human Group 10 secretory phospholipase A2, PLA2G10 ELISA KIT
ELI-37033h 96 Tests
EUR 824
Mouse Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
CSB-EL018085MO-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Mouse Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Rat Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
CSB-EL018085RA-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Rat Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Rat Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Mouse Group 10 secretory phospholipase A2, Pla2g10 ELISA KIT
ELI-16162m 96 Tests
EUR 865
PLA2G10 Secreted Phospholipase A2-X Human Recombinant Protein
PROTO15496 Regular: 10ug
EUR 317
Description: Secreted Phospholipase A2-X Human Recombinant is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag (underlined).;MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQ;PRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQE;LLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD.
ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10)
KTE100470-48T 48T
EUR 332
  • The A2 phospholipases (PLA2s
  • EC catalyze the release of fatty acids from phospholipids and play a role in a wide range of physiologic functions. Cupillard et al. (1997) cloned a novel secretory PLA2, termed GXSPLA2, from a human fetal lung
  • Show more
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10)
KTE100470-5platesof96wells 5 plates of 96 wells
EUR 2115
  • The A2 phospholipases (PLA2s
  • EC catalyze the release of fatty acids from phospholipids and play a role in a wide range of physiologic functions. Cupillard et al. (1997) cloned a novel secretory PLA2, termed GXSPLA2, from a human fetal lung
  • Show more
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10)
KTE100470-96T 96T
EUR 539
  • The A2 phospholipases (PLA2s
  • EC catalyze the release of fatty acids from phospholipids and play a role in a wide range of physiologic functions. Cupillard et al. (1997) cloned a novel secretory PLA2, termed GXSPLA2, from a human fetal lung
  • Show more
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
Human Phospholipase A2, Group IID (PLA2G2D)ELISA kit
201-12-2525 96 tests
EUR 440
  • This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.
Human Phospholipase A2, Group IIA (PLA2G2A)ELISA kit
201-12-2527 96 tests
EUR 440
  • This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.
Human Phospholipase A2, Group IVD (PLA2G4D)ELISA kit
201-12-2529 96 tests
EUR 440
  • This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.
Human Phospholipase A2, Group XIIB (PLA2G12B)ELISA kit
201-12-2530 96 tests
EUR 440
  • This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
DLR-PLA2G12B-Hu-48T 48T
EUR 554
  • Should the Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from serum, plasma, tissue homogenates or other biological fluids.
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
DLR-PLA2G12B-Hu-96T 96T
EUR 725
  • Should the Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from serum, plasma, tissue homogenates or other biological fluids.
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
DLR-PLA2G2A-Hu-48T 48T
EUR 517
  • Should the Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
DLR-PLA2G2A-Hu-96T 96T
EUR 673
  • Should the Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
DLR-PLA2G2D-Hu-48T 48T
EUR 498
  • Should the Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids.
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
DLR-PLA2G2D-Hu-96T 96T
EUR 647
  • Should the Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids.
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit
DLR-PLA2G3-Hu-48T 48T
EUR 517
  • Should the Human Phospholipase A2, Group III (PLA2G3) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids.
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit
DLR-PLA2G3-Hu-96T 96T
EUR 673
  • Should the Human Phospholipase A2, Group III (PLA2G3) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids.
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
DLR-PLA2G4D-Hu-48T 48T
EUR 554
  • Should the Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from tissue homogenates or other biological fluids.
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
DLR-PLA2G4D-Hu-96T 96T
EUR 725
  • Should the Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from tissue homogenates or other biological fluids.
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
DLR-PLA2G5-Hu-48T 48T
EUR 517
  • Should the Human Phospholipase A2, Group V (PLA2G5) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates or other biological fluids.
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
DLR-PLA2G5-Hu-96T 96T
EUR 673
  • Should the Human Phospholipase A2, Group V (PLA2G5) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates or other biological fluids.
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
  • EUR 7112.00
  • EUR 3792.00
  • EUR 879.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.
Human Phospholipase A2 Group VI (PLA2G6) ELISA Kit
abx253845-96tests 96 tests
EUR 668
  • Shipped within 5-12 working days.
Human Group XV phospholipase A2, PLA2G15 ELISA KIT
ELI-21820h 96 Tests
EUR 824
Human Group XVI phospholipase A2, PLA2G16 ELISA KIT
ELI-45167h 96 Tests
EUR 824
Human Group IIA phospholipase A2 (PLA2G2A) ELISA Kit
abx575929-96tests 96 tests
EUR 739
  • Shipped within 5-12 working days.
Human Phospholipase A2, Group XIIB(PLA2G12B)ELISA Kit
QY-E05175 96T
EUR 361
Human Phospholipase A2, Group IVD(PLA2G4D)ELISA Kit
QY-E05205 96T
EUR 361
Human Phospholipase A2, Group IID(PLA2G2D)ELISA Kit
QY-E05226 96T
EUR 361
Human Phospholipase A2, Group IIA(PLA2G2A)ELISA Kit
QY-E05227 96T
EUR 361
Human Phospholipase A2, Group IIA ELISA Kit (PLA2G2A)
RK02095 96 Tests
EUR 521
Human Phospholipase A2, Group IID ELISA Kit (PLA2G2D)
RK02096 96 Tests
EUR 521
Human Phospholipase A2, Group V ELISA Kit (PLA2G5)
RK02097 96 Tests
EUR 521
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Hu-10x96wellstestplate 10x96-wells test plate
EUR 4731.5
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Hu-1x48wellstestplate 1x48-wells test plate
EUR 477.3
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Hu-1x96wellstestplate 1x96-wells test plate
EUR 639
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Hu-5x96wellstestplate 5x96-wells test plate
EUR 2575.5
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
  • EUR 4782.00
  • EUR 2526.00
  • EUR 640.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Phospholipase A2, Group IIA elisa. Alternative names of the recognized antigen: PLA2
  • MOM1
  • PLA2B
  • PLA2L
  • PLA2S
  • PLAS1
  • sPLA2(platelets, synovial fluid)
  • Non-pancreatic secretory phospholipase A2
  • Phosphatidylcholine 2-acylhydrolase 2A
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
SED832Hu-10x96wellstestplate 10x96-wells test plate
EUR 4731.5
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group V (PLA2G5) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
SED832Hu-1x48wellstestplate 1x48-wells test plate
EUR 477.3
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group V (PLA2G5) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
SED832Hu-1x96wellstestplate 1x96-wells test plate
EUR 639
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group V (PLA2G5) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
SED832Hu-5x96wellstestplate 5x96-wells test plate
EUR 2575.5
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group V (PLA2G5) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
  • EUR 4782.00
  • EUR 2526.00
  • EUR 640.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Phospholipase A2, Group V elisa. Alternative names of the recognized antigen: PLA2-10
  • Calcium-dependent phospholipase A2
  • Group V phospholipase A2
  • Phosphatidylcholine 2-acylhydrolase 5
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
SEB077Hu-10x96wellstestplate 10x96-wells test plate
EUR 4502.43
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IID (PLA2G2D) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
SEB077Hu-1x48wellstestplate 1x48-wells test plate
EUR 458.44
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IID (PLA2G2D) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
SEB077Hu-1x96wellstestplate 1x96-wells test plate
EUR 612.05
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IID (PLA2G2D) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
SEB077Hu-5x96wellstestplate 5x96-wells test plate
EUR 2454.23
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IID (PLA2G2D) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
  • EUR 4553.00
  • EUR 2405.00
  • EUR 613.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Phospholipase A2, Group IID elisa. Alternative names of the recognized antigen: PLA2G2D
  • sPLA2S
  • s-PLA2
  • sPLA2
  • Secreted Phospholipase A2
  • Phosphatidylcholine 2-acylhydrolase 2D
  • Secretory-type PLA, stroma-associated homolog
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
RDR-PLA2G12B-Hu-48Tests 48 Tests
EUR 589
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
RDR-PLA2G12B-Hu-96Tests 96 Tests
EUR 820
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RDR-PLA2G2A-Hu-48Tests 48 Tests
EUR 544
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RDR-PLA2G2A-Hu-96Tests 96 Tests
EUR 756
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
RDR-PLA2G2D-Hu-48Tests 48 Tests
EUR 522
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
RDR-PLA2G2D-Hu-96Tests 96 Tests
EUR 724
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit
RDR-PLA2G3-Hu-48Tests 48 Tests
EUR 544
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit
RDR-PLA2G3-Hu-96Tests 96 Tests
EUR 756
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
RDR-PLA2G4D-Hu-48Tests 48 Tests
EUR 589
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
RDR-PLA2G4D-Hu-96Tests 96 Tests
EUR 820
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
RDR-PLA2G5-Hu-48Tests 48 Tests
EUR 544
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
RDR-PLA2G5-Hu-96Tests 96 Tests
EUR 756
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
RD-PLA2G12B-Hu-48Tests 48 Tests
EUR 563
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
RD-PLA2G12B-Hu-96Tests 96 Tests
EUR 783
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RD-PLA2G2A-Hu-48Tests 48 Tests
EUR 521
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RD-PLA2G2A-Hu-96Tests 96 Tests
EUR 723
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
RD-PLA2G2D-Hu-48Tests 48 Tests
EUR 500
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
RD-PLA2G2D-Hu-96Tests 96 Tests
EUR 692
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit
RD-PLA2G3-Hu-48Tests 48 Tests
EUR 521
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit
RD-PLA2G3-Hu-96Tests 96 Tests
EUR 723
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
RD-PLA2G4D-Hu-48Tests 48 Tests
EUR 563
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
RD-PLA2G4D-Hu-96Tests 96 Tests
EUR 783
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
RD-PLA2G5-Hu-48Tests 48 Tests
EUR 521
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
RD-PLA2G5-Hu-96Tests 96 Tests
EUR 723
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
SEM563Hu-10x96wellstestplate 10x96-wells test plate
EUR 5189.65
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IVD (PLA2G4D) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids.
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
SEM563Hu-1x48wellstestplate 1x48-wells test plate
EUR 515.03
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IVD (PLA2G4D) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids.
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
SEM563Hu-1x96wellstestplate 1x96-wells test plate
EUR 692.9
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IVD (PLA2G4D) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids.
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
SEM563Hu-5x96wellstestplate 5x96-wells test plate
EUR 2818.05
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IVD (PLA2G4D) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids.
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
  • EUR 5240.00
  • EUR 2769.00
  • EUR 693.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Phospholipase A2, Group IVD elisa. Alternative names of the recognized antigen: cPLA2delta
  • Cytosolic phospholipase A2 delta
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
SEN729Hu-10x96wellstestplate 10x96-wells test plate
EUR 5189.65
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group XIIB (PLA2G12B) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Ass
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
SEN729Hu-1x48wellstestplate 1x48-wells test plate
EUR 515.03
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group XIIB (PLA2G12B) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Ass
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
SEN729Hu-1x96wellstestplate 1x96-wells test plate
EUR 692.9
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group XIIB (PLA2G12B) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Ass
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
SEN729Hu-5x96wellstestplate 5x96-wells test plate
EUR 2818.05
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group XIIB (PLA2G12B) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Ass
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids.
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
  • EUR 5240.00
  • EUR 2769.00
  • EUR 693.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Phospholipase A2, Group XIIB elisa. Alternative names of the recognized antigen: PLA2G13
  • FKSG71
  • Phospholipase A2, Group XIII
  • Group XIIB secretory phospholipase A2-like protein
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from Serum, plasma, tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.
Phospholipase A2, Group Ive Antibody
  • EUR 732.00
  • EUR 398.00
  • 150 ul
  • 50 ul
  • Shipped within 5-10 working days.
Phospholipase A2, Group Ivf Antibody
  • EUR 732.00
  • EUR 398.00
  • 150 ul
  • 50 ul
  • Shipped within 5-10 working days.
Phospholipase A2, Group Xiia Antibody
  • EUR 732.00
  • EUR 398.00
  • 150 ul
  • 50 ul
  • Shipped within 5-10 working days.
Phospholipase A2, Group Xiib Antibody
  • EUR 732.00
  • EUR 398.00
  • 150 ul
  • 50 ul
  • Shipped within 5-10 working days.
Secreted Phospholipase A2-X (Recombinant)
  • EUR 328.00
  • EUR 5311.00
  • EUR 230.00
  • 10 ug
  • 1 mg
  • 2 µg
  • Shipped within 5-10 working days.
Recombinant Human Secreted Phospholipase A2-X
7-03355 2µg Ask for price
Recombinant Human Secreted Phospholipase A2-X
7-03356 10µg Ask for price
Recombinant Human Secreted Phospholipase A2-X
7-03357 1mg Ask for price
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
DLR-PLA2G2A-Mu-48T 48T
EUR 527
  • Should the Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
DLR-PLA2G2A-Mu-96T 96T
EUR 688
  • Should the Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
DLR-PLA2G2A-Ra-48T 48T
EUR 549
  • Should the Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
DLR-PLA2G2A-Ra-96T 96T
EUR 718
  • Should the Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
DLR-PLA2G2D-Mu-48T 48T
EUR 508
  • Should the Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids.
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
DLR-PLA2G2D-Mu-96T 96T
EUR 661
  • Should the Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids.
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
DLR-PLA2G3-Mu-48T 48T
EUR 527
  • Should the Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids.
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
DLR-PLA2G3-Mu-96T 96T
EUR 688
  • Should the Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids.
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
  • EUR 7237.00
  • EUR 3855.00
  • EUR 895.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
  • EUR 7237.00
  • EUR 3855.00
  • EUR 895.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
abx254356-96tests 96 tests
EUR 707
  • Shipped within 5-12 working days.
Rat Group IIA phospholipase A2 (PLA2G2A) ELISA Kit
abx255942-96tests 96 tests
EUR 707
  • Shipped within 5-12 working days.
Bovine Group XV phospholipase A2, PLA2G15 ELISA KIT
ELI-14523b 96 Tests
EUR 928
Mouse Group XV phospholipase A2, Pla2g15 ELISA KIT
ELI-14703m 96 Tests
EUR 865
Cow Group IIA phospholipase A2 (PLA2G2A) ELISA Kit
abx520902-96tests 96 tests
EUR 911
  • Shipped within 5-12 working days.
Rat Group IIA phospholipase A2 (PLA2G2A) ELISA Kit
abx572864-96tests 96 tests
EUR 707
  • Shipped within 5-12 working days.
Mouse Group IIA phospholipase A2 (PLA2G2A) ELISA Kit
abx575023-96tests 96 tests
EUR 739
  • Shipped within 5-12 working days.
Mouse Phospholipase A2 Group VI (PLA2G6) ELISA Kit
abx512875-96tests 96 tests
EUR 668
  • Shipped within 5-12 working days.
Rat Phospholipase A2 Group VI (PLA2G6) ELISA Kit
abx512877-96tests 96 tests
EUR 668
  • Shipped within 5-12 working days.
Mouse PLA2G2D(Phospholipase A2, Group IID) ELISA Kit
EM1297 96T
EUR 524.1
  • Detection range: 31.25-2000 pg/ml
  • Uniprot ID: Q9WVF6
  • Alias: PLA2G2D
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 18.75pg/ml
Rat PLA2G2A(Phospholipase A2,Group IIA) ELISA Kit
ER1276 96T
EUR 524.1
  • Detection range: 0.156-10 ng/ml
  • Uniprot ID: P14423
  • Alias: PLA2G2A/Mom1/PLA2B/PLA2L/RASF-A/GIIC sPLA2/Group IIA phospholipase A2/MOM1/Non-pancreatic secretory phospholipase A2/NPS-PLA2/Phosphatidylcholine 2-acylhydrolase 2A/phospholipase A2, group IIA
  • Show more
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Rattus;Sensitivity: 0.094 ng/ml
Mouse Group XVI phospholipase A2, Pla2g16 ELISA KIT
ELI-37775m 96 Tests
EUR 865
Rat Phospholipase A2, Group IIA(PLA2G2A)ELISA Kit
QY-E10194 96T
EUR 361
Rat Phospholipase A2(Group IVD(PLA2G4D)ELISA kit
QY-E10542 96T
EUR 413
Rat Phospholipase A2(Group IID(PLA2G2D)ELISA kit
QY-E10543 96T
EUR 413
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Mu-10x96wellstestplate 10x96-wells test plate
EUR 4862.4
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Mu-1x48wellstestplate 1x48-wells test plate
EUR 488.08
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Mu-1x96wellstestplate 1x96-wells test plate
EUR 654.4
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Mu-5x96wellstestplate 5x96-wells test plate
EUR 2644.8
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
  • EUR 4913.00
  • EUR 2595.00
  • EUR 655.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Phospholipase A2, Group IIA elisa. Alternative names of the recognized antigen: PLA2
  • MOM1
  • PLA2B
  • PLA2L
  • PLA2S
  • PLAS1
  • sPLA2(platelets, synovial fluid)
  • Non-pancreatic secretory phospholipase A2
  • Phosphatidylcholine 2-acylhydrolase 2A
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Ra-10x96wellstestplate 10x96-wells test plate
EUR 5124.2
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay:
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Ra-1x48wellstestplate 1x48-wells test plate
EUR 509.64
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay:
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Ra-1x96wellstestplate 1x96-wells test plate
EUR 685.2
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay:
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Ra-5x96wellstestplate 5x96-wells test plate
EUR 2783.4
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay:
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
  • EUR 5175.00
  • EUR 2734.00
  • EUR 686.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Phospholipase A2, Group IIA elisa. Alternative names of the recognized antigen: PLA2
  • MOM1
  • PLA2B
  • PLA2L
  • PLA2S
  • PLAS1
  • sPLA2(platelets, synovial fluid)
  • Non-pancreatic secretory phospholipase A2
  • Phosphatidylcholine 2-acylhydrolase 2A
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in samples from Serum, plasma, tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
SED831Mu-10x96wellstestplate 10x96-wells test plate
EUR 4862.4
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group III (PLA2G3) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay:
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group III (PLA2G3) in serum, plasma and other biological fluids.
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
SED831Mu-1x48wellstestplate 1x48-wells test plate
EUR 488.08
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group III (PLA2G3) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay:
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group III (PLA2G3) in serum, plasma and other biological fluids.
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
SED831Mu-1x96wellstestplate 1x96-wells test plate
EUR 654.4
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group III (PLA2G3) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay:
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group III (PLA2G3) in serum, plasma and other biological fluids.
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
SED831Mu-5x96wellstestplate 5x96-wells test plate
EUR 2644.8
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group III (PLA2G3) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay:
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group III (PLA2G3) in serum, plasma and other biological fluids.
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
  • EUR 4913.00
  • EUR 2595.00
  • EUR 655.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Phospholipase A2, Group III elisa. Alternative names of the recognized antigen: GIII-SPLA2
  • sPLA2-III
  • Group 3 secretory phospholipase A2
  • Group III secretory phospholipase A2
  • Phosphatidylcholine 2-acylhydrolase 3
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Phospholipase A2, Group III (PLA2G3) in samples from Serum, plasma and other biological fluids. with no significant corss-reactivity with analogues from other species.
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
SEB077Mu-10x96wellstestplate 10x96-wells test plate
EUR 4626.78
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group IID (PLA2G2D) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
SEB077Mu-1x48wellstestplate 1x48-wells test plate
EUR 468.68
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group IID (PLA2G2D) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
SEB077Mu-1x96wellstestplate 1x96-wells test plate
EUR 626.68
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group IID (PLA2G2D) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
SEB077Mu-5x96wellstestplate 5x96-wells test plate
EUR 2520.06
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group IID (PLA2G2D) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
  • EUR 4677.00
  • EUR 2471.00
  • EUR 627.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Phospholipase A2, Group IID elisa. Alternative names of the recognized antigen: PLA2G2D
  • sPLA2S
  • s-PLA2
  • sPLA2
  • Secreted Phospholipase A2
  • Phosphatidylcholine 2-acylhydrolase 2D
  • Secretory-type PLA, stroma-associated homolog
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in samples from Serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.
Mouse Phospholipase A2(Group IID(PLA2G2D)ELISA kit
QY-E21172 96T
EUR 361
Mouse Phospholipase A2(Group IVD(PLA2G4D)ELISA kit
QY-E21173 96T
EUR 361
Mouse Phospholipase A2, Group IIA(PLA2G2A)ELISA Kit
QY-E21175 96T
EUR 361
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RDR-PLA2G2A-Mu-48Tests 48 Tests
EUR 557
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RDR-PLA2G2A-Mu-96Tests 96 Tests
EUR 774
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RDR-PLA2G2A-Ra-48Tests 48 Tests
EUR 583
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RDR-PLA2G2A-Ra-96Tests 96 Tests
EUR 811
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
RDR-PLA2G2D-Mu-48Tests 48 Tests
EUR 534
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
RDR-PLA2G2D-Mu-96Tests 96 Tests
EUR 742
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
RDR-PLA2G3-Mu-48Tests 48 Tests
EUR 557
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
RDR-PLA2G3-Mu-96Tests 96 Tests
EUR 774
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RD-PLA2G2A-Mu-48Tests 48 Tests
EUR 533
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RD-PLA2G2A-Mu-96Tests 96 Tests
EUR 740
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RD-PLA2G2A-Ra-48Tests 48 Tests
EUR 557
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RD-PLA2G2A-Ra-96Tests 96 Tests
EUR 775
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
RD-PLA2G2D-Mu-48Tests 48 Tests
EUR 511
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
RD-PLA2G2D-Mu-96Tests 96 Tests
EUR 709
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
RD-PLA2G3-Mu-48Tests 48 Tests
EUR 533
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
RD-PLA2G3-Mu-96Tests 96 Tests
EUR 740
ELISA kit for Human PLA2G12B (Phospholipase A2, Group ? B)
E-EL-H1029 1 plate of 96 wells
EUR 534
  • Gentaur's PLA2G12B ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human PLA2G12B. Standards or samples are added to the micro ELISA plate wells and combined
  • Show more
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G12B (Phospholipase A2, Group ? B) in samples from Serum, Plasma, Cell supernatant
ELISA kit for Human PLA2G4D (Phospholipase A2, Group ? D)
E-EL-H1048 1 plate of 96 wells
EUR 534
  • Gentaur's PLA2G4D ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human PLA2G4D. Standards or samples are added to the micro ELISA plate wells and combined w
  • Show more
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G4D (Phospholipase A2, Group ? D) in samples from Serum, Plasma, Cell supernatant
ELISA kit for Human PLA2G2D (Phospholipase A2, Group ?D)
E-EL-H2384 1 plate of 96 wells
EUR 534
  • Gentaur's PLA2G2D ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human PLA2G2D. Standards or samples are added to the micro ELISA plate wells and combined w
  • Show more
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G2D (Phospholipase A2, Group ?D) in samples from Serum, Plasma, Cell supernatant
ELISA kit for Human PLA2G2A (Phospholipase A2, Group ?A)
E-EL-H2385 1 plate of 96 wells
EUR 534
  • Gentaur's PLA2G2A ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human PLA2G2A. Standards or samples are added to the micro ELISA plate wells and combined w
  • Show more
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G2A (Phospholipase A2, Group ?A) in samples from Serum, Plasma, Cell supernatant
Human Group XIIA secretory phospholipase A2(PLA2G12A) ELISA kit
CSB-EL018086HU-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativecompetitive ELISA kit for measuring Human Group XIIA secretory phospholipase A2 (PLA2G12A) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Human Group XIIA secretory phospholipase A2(PLA2G12A) ELISA kit
  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativecompetitive ELISA kit for measuring Human Group XIIA secretory phospholipase A2(PLA2G12A) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Human Group IIF secretory phospholipase A2(PLA2G2F) ELISA kit
CSB-EL018095HU-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Group IIF secretory phospholipase A2 (PLA2G2F) in samples from serum, plasma, tissue, homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Human Group IIF secretory phospholipase A2(PLA2G2F) ELISA kit
  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Group IIF secretory phospholipase A2(PLA2G2F) in samples from serum, plasma, tissue, homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Human Phospholipase A2, Group II A (PLA2G2A) ELISA Kit
abx251779-96tests 96 tests
EUR 754
  • Shipped within 5-12 working days.
Human Phospholipase A2, Group XII B (PLA2G12B) ELISA Kit
abx252991-96tests 96 tests
EUR 707
  • Shipped within 5-12 working days.
Human Phospholipase A2, Group IV D (PLA2G4D) ELISA Kit
abx252993-96tests 96 tests
EUR 707
  • Shipped within 5-12 working days.
Human PLA2G12B(Phospholipase A2, Group XII B) ELISA Kit
EH3604 96T
EUR 524.1
  • Detection range: 0.156-10 ng/ml
  • Uniprot ID: Q9BX93
  • Alias: PLA2G12B
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.094 ng/ml
Human PLA2G4D(Phospholipase A2, Group IV D) ELISA Kit
EH3606 96T
EUR 524.1
  • Detection range: 0.156-10 ng/ml
  • Uniprot ID: Q86XP0
  • Alias: PLA2G4D
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.094 ng/ml
Human Group XIIA secretory phospholipase A2, PLA2G12A ELISA KIT
ELI-21567h 96 Tests
EUR 824
Human Group IIF secretory phospholipase A2, PLA2G2F ELISA KIT
ELI-23295h 96 Tests
EUR 824
ELISA kit for Human PLA2G2A (Phospholipase A2, Group IIA)
ELK3752 1 plate of 96 wells
EUR 432
  • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Phospholipase A2, Group IIA (PLA2G2A). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific
  • Show more
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group IIA from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.
ELISA kit for Human PLA2G5 (Phospholipase A2, Group V)
ELK4777 1 plate of 96 wells
EUR 432
  • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Phospholipase A2, Group V (PLA2G5). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific to
  • Show more
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group V from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.
ELISA kit for Human PLA2G2D (Phospholipase A2, Group IID)
ELK1754 1 plate of 96 wells
EUR 432
  • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Phospholipase A2, Group IID (PLA2G2D). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific
  • Show more
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group IID from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.
Human Group IID secretory phospholipase A2, PLA2G2D ELISA KIT
ELI-45186h 96 Tests
EUR 824
Human Phospholipase A2, Group II D (PLA2G2D) ELISA Kit
abx354458-96tests 96 tests
EUR 707
  • Shipped within 5-12 working days.
Human Phospholipase A2 Group XII A (PLA2G12A) ELISA Kit
abx382266-96tests 96 tests
EUR 911
  • Shipped within 5-12 working days.
Human Phospholipase A2 Group IV B (PLA2G4B) ELISA Kit
abx382267-96tests 96 tests
EUR 911
  • Shipped within 5-12 working days.
Human Phospholipase A2 Group IV E (PLA2G4E) ELISA Kit
abx382268-96tests 96 tests
EUR 911
  • Shipped within 5-12 working days.
Human Phospholipase A2 Group IV F (PLA2G4E) ELISA Kit
  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-12 working days.
ELISA kit for Human PLA2G12B (Phospholipase A2, Group XIIB)
ELK6117 1 plate of 96 wells
EUR 432
  • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Phospholipase A2, Group XIIB (PLA2G12B). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specif
  • Show more
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group XIIB from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.
ELISA kit for Human PLA2G4D (Phospholipase A2, Group IVD)
ELK6188 1 plate of 96 wells
EUR 432
  • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Phospholipase A2, Group IVD (PLA2G4D). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific
  • Show more
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group IVD from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.
Human Group IIE secretory phospholipase A2, PLA2G2E ELISA KIT
ELI-35519h 96 Tests
EUR 824
Human Group 3 secretory phospholipase A2, PLA2G3 ELISA KIT
ELI-37656h 96 Tests
EUR 824
Human Phospholipase A2, Group IIA (PLA2G2A) CLIA Kit
  • EUR 7973.00
  • EUR 4246.00
  • EUR 981.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Please enquire.
Human Phospholipase A2, Group V (PLA2G5) CLIA Kit
  • EUR 7973.00
  • EUR 4246.00
  • EUR 981.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Please enquire.
Human Phospholipase A2, Group IID (PLA2G2D) CLIA Kit
  • EUR 7973.00
  • EUR 4246.00
  • EUR 981.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Please enquire.
Human Phospholipase A2, Group IVD (PLA2G4D) CLIA Kit
  • EUR 8569.00
  • EUR 4560.00
  • EUR 1052.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Please enquire.
Human Phospholipase A2, Group XIIB (PLA2G12B) CLIA Kit
  • EUR 8569.00
  • EUR 4560.00
  • EUR 1052.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Please enquire.
Human Group IID secretory phospholipase A2 (PLA2G2D)
  • EUR 380.00
  • EUR 214.00
  • EUR 1309.00
  • EUR 560.00
  • EUR 873.00
  • EUR 262.00
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
  • MW: 30.5 kDa
  • Buffer composition: Tris-based buffer with 50% glycerol.
Description: Recombinant Human Group IID secretory phospholipase A2(PLA2G2D),partial expressed in E.coli
Human Group XIIA secretory phospholipase A2 (PLA2G12A)
  • EUR 430.00
  • EUR 234.00
  • EUR 1508.00
  • EUR 642.00
  • EUR 1009.00
  • EUR 291.00
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
  • MW: 20.3 kDa
  • Buffer composition: Tris-based buffer with 50% glycerol.
Description: Recombinant Human Group XIIA secretory phospholipase A2(PLA2G12A),partial expressed in Yeast
Human Phospholipase A2, Group IIA (PLA2G2A) Protein
  • EUR 676.00
  • EUR 286.00
  • EUR 2082.00
  • EUR 801.00
  • EUR 481.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Human Phospholipase A2, Group IID (PLA2G2D) Protein
  • EUR 578.00
  • EUR 258.00
  • EUR 1720.00
  • EUR 690.00
  • EUR 425.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-15 working days.
Human Phospholipase A2, Group V (PLA2G5) Protein
  • EUR 578.00
  • EUR 258.00
  • EUR 1720.00
  • EUR 690.00
  • EUR 425.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-15 working days.
Human Phospholipase A2, Group XIIB (PLA2G12B) Protein
  • EUR 578.00
  • EUR 258.00
  • EUR 1720.00
  • EUR 690.00
  • EUR 425.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-15 working days.
Human Phospholipase A2, Group III (PLA2G3) Protein
  • EUR 704.00
  • EUR 286.00
  • EUR 2165.00
  • EUR 829.00
  • EUR 495.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Human Phospholipase A2, Group XII (PLA2G12) Protein
  • EUR 704.00
  • EUR 286.00
  • EUR 2193.00
  • EUR 843.00
  • EUR 509.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Human Phospholipase A2, Group IVD (PLA2G4D) Protein
  • EUR 648.00
  • EUR 272.00
  • EUR 1943.00
  • EUR 759.00
  • EUR 467.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Mouse Group XV phospholipase A2 (Pla2g15)
  • EUR 505.00
  • EUR 265.00
  • EUR 1827.00
  • EUR 766.00
  • EUR 1218.00
  • EUR 335.00
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
  • MW: 50.5 kDa
  • Buffer composition: Tris-based buffer with 50% glycerol.
Description: Recombinant Mouse Group XV phospholipase A2 (Pla2g15) expressed in E.coli
Phospholipase A2 Group IVC (PLA2G4C) Antibody
  • EUR 411.00
  • EUR 592.00
  • EUR 182.00
  • EUR 314.00
  • 100 ul
  • 200 ul
  • 20 ul
  • 50 ul
  • Shipped within 5-10 working days.
Phospholipase A2, Group V (PLA2G5) Antibody
abx028287-400ul 400 ul
EUR 523
  • Shipped within 5-10 working days.
Phospholipase A2, Group V (PLA2G5) Antibody
abx028287-80l 80 µl
EUR 286
  • Shipped within 5-10 working days.
Phospholipase A2, Group IIA (PLA2G2A) Antibody
  • EUR 1233.00
  • EUR 592.00
  • 1 mg
  • 200 ug
  • Please enquire.
Phospholipase A2, Group IIA (PLA2G2A) Antibody
  • EUR 1233.00
  • EUR 592.00
  • 1 mg
  • 200 ug
  • Please enquire.
Phospholipase A2, Group IID (PLA2G2D) Antibody
  • EUR 1149.00
  • EUR 565.00
  • 1 mg
  • 200 ug
  • Please enquire.
Phospholipase A2, Group IID (PLA2G2D) Antibody
  • EUR 1177.00
  • EUR 578.00
  • 1 mg
  • 200 ug
  • Please enquire.
Phospholipase A2, Group III (PLA2G3) Antibody
  • EUR 1233.00
  • EUR 592.00
  • 1 mg
  • 200 ug
  • Please enquire.
Phospholipase A2, Group III (PLA2G3) Antibody
  • EUR 1233.00
  • EUR 592.00
  • 1 mg
  • 200 ug
  • Please enquire.
Phospholipase A2, Group V (PLA2G5) Antibody
  • EUR 1205.00
  • EUR 578.00
  • 1 mg
  • 200 ug
  • Please enquire.
Phospholipase A2, Group XIIB (PLA2G12B) Antibody
  • EUR 1316.00
  • EUR 620.00
  • 1 mg
  • 200 ug
  • Please enquire.
Phospholipase A2, Group IIA (PLA2G2A) Antibody
  • EUR 453.00
  • EUR 133.00
  • EUR 1302.00
  • EUR 620.00
  • EUR 342.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Phospholipase A2, Group IID (PLA2G2D) Antibody
  • EUR 300.00
  • EUR 133.00
  • EUR 801.00
  • EUR 425.00
  • EUR 258.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Phospholipase A2, Group Ivd (Cytosolic) Antibody
  • EUR 732.00
  • EUR 398.00
  • 150 ul
  • 50 ul
  • Shipped within 5-10 working days.
Phospholipase A2 Group VI (PLA2G6) Antibody
  • EUR 411.00
  • EUR 592.00
  • EUR 182.00
  • EUR 314.00
  • 100 ul
  • 200 ul
  • 20 ul
  • 50 ul
  • Shipped within 5-10 working days.
Phospholipase A2, Group IIA (PLA2G2A) Antibody
  • EUR 425.00
  • EUR 133.00
  • EUR 1205.00
  • EUR 578.00
  • EUR 328.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Phospholipase A2, Group IID (PLA2G2D) Antibody
  • EUR 439.00
  • EUR 133.00
  • EUR 1233.00
  • EUR 592.00
  • EUR 328.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Phospholipase A2, Group IVD (PLA2G4D) Antibody
  • EUR 453.00
  • EUR 133.00
  • EUR 1316.00
  • EUR 620.00
  • EUR 342.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Phospholipase A2, Group III (PLA2G3) Antibody
  • EUR 328.00
  • EUR 133.00
  • EUR 871.00
  • EUR 453.00
  • EUR 272.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Phospholipase A2, Group III (PLA2G3) Antibody
  • EUR 425.00
  • EUR 133.00
  • EUR 1205.00
  • EUR 578.00
  • EUR 328.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Phospholipase A2, Group XII (PLA2G12) Antibody
  • EUR 439.00
  • EUR 133.00
  • EUR 1233.00
  • EUR 592.00
  • EUR 328.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Phospholipase A2, Group XII (PLA2G12) Antibody
  • EUR 425.00
  • EUR 133.00
  • EUR 1205.00
  • EUR 578.00
  • EUR 328.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.