May 16, 2022

Human PLA2G10(Phospholipase A2, Group X) ELISA Kit

Human PLA2G10(Phospholipase A2, Group X) ELISA Kit

To Order Contact us: michael@lotusbiotechnologies.com

Phospholipase A2, Group X (PLA2G10) Antibody

20-abx128169
  • EUR 425.00
  • EUR 133.00
  • EUR 1205.00
  • EUR 578.00
  • EUR 328.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Phospholipase A2, Group X (PLA2G10) Antibody

20-abx174048
  • EUR 857.00
  • EUR 439.00
  • 1 mg
  • 200 ug

Phospholipase A2, Group X (PLA2G10) Antibody

20-abx301835
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit

SED833Hu-10x96wellstestplate 10x96-wells test plate
EUR 4731.5
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit

SED833Hu-1x48wellstestplate 1x48-wells test plate
EUR 477.3
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit

SED833Hu-1x96wellstestplate 1x96-wells test plate
EUR 639
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit

SED833Hu-5x96wellstestplate 5x96-wells test plate
EUR 2575.5
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit

4-SED833Hu
  • EUR 4782.00
  • EUR 2526.00
  • EUR 640.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group X (PLA2G10) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species.

Human Phospholipase A2, Group X (PLA2G10)ELISA kit

201-12-2526 96 tests
EUR 440
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit

20-abx152758
  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit

abx252990-96tests 96 tests
EUR 668

Human Phospholipase A2, Group X(PLA2G10)ELISA Kit

QY-E05176 96T
EUR 361

Human PLA2G10(Phospholipase A2, Group X) ELISA Kit

EH3603 96T
EUR 524.1
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 4.688pg/ml

Human Phospholipase A2, Group X (PLA2G10) Protein

20-abx167064
  • EUR 704.00
  • EUR 286.00
  • EUR 2165.00
  • EUR 829.00
  • EUR 495.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Monkey Phospholipase A2, Group X (PLA2G10) ELISA Kit

abx360270-96tests 96 tests
EUR 825

Pig Phospholipase A2, Group X (PLA2G10) ELISA Kit

abx362012-96tests 96 tests
EUR 825

Rabbit Phospholipase A2, Group X (PLA2G10) ELISA Kit

abx362347-96tests 96 tests
EUR 825

Chicken Phospholipase A2, Group X (PLA2G10) ELISA Kit

abx356098-96tests 96 tests
EUR 825

Human Phospholipase A2, Group X (PLA2G10) CLIA Kit

20-abx494408
  • EUR 7973.00
  • EUR 4246.00
  • EUR 981.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Phospholipase A2, Group X (PLA2G10) CLIA Kit

abx197460-96tests 96 tests
EUR 825

ELISA kit for Human PLA2G10 (Phospholipase A2, Group X)

E-EL-H1011 1 plate of 96 wells
EUR 534
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G10 (Phospholipase A2, Group X) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Human PLA2G10 (Phospholipase A2, Group X)

ELK4236 1 plate of 96 wells
EUR 432
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group X from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Phospholipase A2, Group X (PLA2G10) Antibody (HRP)

20-abx315919
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Phospholipase A2, Group X (PLA2G10) Antibody (FITC)

20-abx315920
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Phospholipase A2, Group X (PLA2G10) Antibody (Biotin)

20-abx315921
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human)

4-PAD833Hu01
  • EUR 247.00
  • EUR 2510.00
  • EUR 625.00
  • EUR 310.00
  • EUR 214.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10)

CLIA kit for Human PLA2G10 (Phospholipase A2, Group X)

E-CL-H0681 1 plate of 96 wells
EUR 584
Description: A sandwich CLIA kit for quantitative measurement of Human PLA2G10 (Phospholipase A2, Group X) in samples from Serum, Plasma, Cell supernatant

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), APC

4-PAD833Hu01-APC
  • EUR 345.00
  • EUR 3275.00
  • EUR 912.00
  • EUR 440.00
  • EUR 219.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with APC.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), Biotinylated

4-PAD833Hu01-Biotin
  • EUR 311.00
  • EUR 2460.00
  • EUR 727.00
  • EUR 381.00
  • EUR 219.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with Biotin.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), Cy3

4-PAD833Hu01-Cy3
  • EUR 419.00
  • EUR 4325.00
  • EUR 1175.00
  • EUR 545.00
  • EUR 251.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with Cy3.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), FITC

4-PAD833Hu01-FITC
  • EUR 296.00
  • EUR 2640.00
  • EUR 750.00
  • EUR 372.00
  • EUR 195.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with FITC.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), HRP

4-PAD833Hu01-HRP
  • EUR 316.00
  • EUR 2855.00
  • EUR 807.00
  • EUR 398.00
  • EUR 206.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with HRP.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), PE

4-PAD833Hu01-PE
  • EUR 296.00
  • EUR 2640.00
  • EUR 750.00
  • EUR 372.00
  • EUR 195.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with PE.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), APC-Cy7

4-PAD833Hu01-APC-Cy7
  • EUR 571.00
  • EUR 6430.00
  • EUR 1705.00
  • EUR 760.00
  • EUR 319.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with APC-Cy7.

Human Group 10 secretory phospholipase A2(PLA2G10) ELISA kit

CSB-EL018085HU-24T 1 plate of 24 wells
EUR 165
Description: Quantitativesandwich ELISA kit for measuring Human Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Group 10 secretory phospholipase A2(PLA2G10) ELISA kit

1-CSB-EL018085HU
  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Human Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Human Group 10 secretory phospholipase A2, PLA2G10 ELISA KIT

ELI-37033h 96 Tests
EUR 824

Mouse Group 10 secretory phospholipase A2(PLA2G10) ELISA kit

CSB-EL018085MO-24T 1 plate of 24 wells
EUR 165
Description: Quantitativesandwich ELISA kit for measuring Mouse Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse Group 10 secretory phospholipase A2(PLA2G10) ELISA kit

1-CSB-EL018085MO
  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Mouse Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Rat Group 10 secretory phospholipase A2(PLA2G10) ELISA kit

CSB-EL018085RA-24T 1 plate of 24 wells
EUR 165
Description: Quantitativesandwich ELISA kit for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Rat Group 10 secretory phospholipase A2(PLA2G10) ELISA kit

1-CSB-EL018085RA
  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Rat Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse Group 10 secretory phospholipase A2, Pla2g10 ELISA KIT

ELI-16162m 96 Tests
EUR 865

PLA2G10 Secreted Phospholipase A2-X Human Recombinant Protein

PROTO15496 Regular: 10ug
EUR 317
Description: Secreted Phospholipase A2-X Human Recombinant is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag (underlined).;MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQ;PRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQE;LLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD.

ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10)

KTE100470-96T 96T
EUR 539
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10)

KTE100470-48T 48T
EUR 332
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10)

KTE100470-5platesof96wells 5 plates of 96 wells
EUR 2115
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

SEB077Hu-10x96wellstestplate 10x96-wells test plate
EUR 4502.43
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

SEB077Hu-1x48wellstestplate 1x48-wells test plate
EUR 458.44
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

SEB077Hu-1x96wellstestplate 1x96-wells test plate
EUR 612.05
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

SEB077Hu-5x96wellstestplate 5x96-wells test plate
EUR 2454.23
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

4-SEB077Hu
  • EUR 4553.00
  • EUR 2405.00
  • EUR 613.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

SED827Hu-10x96wellstestplate 10x96-wells test plate
EUR 4731.5
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

SED827Hu-1x48wellstestplate 1x48-wells test plate
EUR 477.3
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

SED827Hu-1x96wellstestplate 1x96-wells test plate
EUR 639
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

SED827Hu-5x96wellstestplate 5x96-wells test plate
EUR 2575.5
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

4-SED827Hu
  • EUR 4782.00
  • EUR 2526.00
  • EUR 640.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit

SED832Hu-10x96wellstestplate 10x96-wells test plate
EUR 4731.5
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit

SED832Hu-1x48wellstestplate 1x48-wells test plate
EUR 477.3
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit

SED832Hu-1x96wellstestplate 1x96-wells test plate
EUR 639
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit

SED832Hu-5x96wellstestplate 5x96-wells test plate
EUR 2575.5
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit

4-SED832Hu
  • EUR 4782.00
  • EUR 2526.00
  • EUR 640.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit

SEM563Hu-10x96wellstestplate 10x96-wells test plate
EUR 5189.65
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit

SEM563Hu-1x48wellstestplate 1x48-wells test plate
EUR 515.03
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit

SEM563Hu-1x96wellstestplate 1x96-wells test plate
EUR 692.9
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit

SEM563Hu-5x96wellstestplate 5x96-wells test plate
EUR 2818.05
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit

4-SEM563Hu
  • EUR 5240.00
  • EUR 2769.00
  • EUR 693.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

SEN729Hu-10x96wellstestplate 10x96-wells test plate
EUR 5189.65
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

SEN729Hu-1x48wellstestplate 1x48-wells test plate
EUR 515.03
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

SEN729Hu-1x96wellstestplate 1x96-wells test plate
EUR 692.9
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

SEN729Hu-5x96wellstestplate 5x96-wells test plate
EUR 2818.05
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

4-SEN729Hu
  • EUR 5240.00
  • EUR 2769.00
  • EUR 693.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from Serum, plasma, tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.

Human Phospholipase A2, Group IID ELISA Kit (PLA2G2D)

RK02096 96 Tests
EUR 521

Human Phospholipase A2, Group IIA ELISA Kit (PLA2G2A)

RK02095 96 Tests
EUR 521

Human Phospholipase A2, Group V ELISA Kit (PLA2G5)

RK02097 96 Tests
EUR 521

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

RD-PLA2G12B-Hu-48Tests 48 Tests
EUR 563

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

RD-PLA2G12B-Hu-96Tests 96 Tests
EUR 783

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

RD-PLA2G2A-Hu-48Tests 48 Tests
EUR 521

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

RD-PLA2G2A-Hu-96Tests 96 Tests
EUR 723

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

RD-PLA2G2D-Hu-48Tests 48 Tests
EUR 500

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

RD-PLA2G2D-Hu-96Tests 96 Tests
EUR 692

Human Phospholipase A2, Group III (PLA2G3) ELISA Kit

RD-PLA2G3-Hu-48Tests 48 Tests
EUR 521

Human Phospholipase A2, Group III (PLA2G3) ELISA Kit

RD-PLA2G3-Hu-96Tests 96 Tests
EUR 723

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit

RD-PLA2G4D-Hu-48Tests 48 Tests
EUR 563

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit

RD-PLA2G4D-Hu-96Tests 96 Tests
EUR 783

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit

RD-PLA2G5-Hu-48Tests 48 Tests
EUR 521

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit

RD-PLA2G5-Hu-96Tests 96 Tests
EUR 723

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

DLR-PLA2G12B-Hu-48T 48T
EUR 554
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

DLR-PLA2G12B-Hu-96T 96T
EUR 725
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

DLR-PLA2G2A-Hu-48T 48T
EUR 517
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

DLR-PLA2G2A-Hu-96T 96T
EUR 673
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

DLR-PLA2G2D-Hu-48T 48T
EUR 498
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

DLR-PLA2G2D-Hu-96T 96T
EUR 647
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids.