February 5, 2023

Human PLA2G10(Phospholipase A2, Group X) ELISA Kit

Human PLA2G10(Phospholipase A2, Group X) ELISA Kit

To Order Contact us: michael@lotusbiotechnologies.com

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit

abx252990-96tests Abbexa 96 tests 801.6 EUR

Human PLA2G10(Phospholipase A2, Group X) ELISA Kit

EH3603 FN Test 96T 628.92 EUR
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 4.688pg/ml

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit

SED833Hu-10x96wellstestplate Cloud-Clone 10x96-wells test plate 5677.8 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit

SED833Hu-1x48wellstestplate Cloud-Clone 1x48-wells test plate 572.76 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit

SED833Hu-1x96wellstestplate Cloud-Clone 1x96-wells test plate 766.8 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit

SED833Hu-5x96wellstestplate Cloud-Clone 5x96-wells test plate 3090.6 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit

4-SED833Hu Cloud-Clone
  • 5738.40 EUR
  • 3031.20 EUR
  • 768.00 EUR
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group X (PLA2G10) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species.

Human Phospholipase A2, Group X(PLA2G10)ELISA Kit

QY-E05176 Qayee Biotechnology 96T 433.2 EUR

Phospholipase A2, Group X (PLA2G10) Antibody

20-abx126373 Abbexa
  • 493.20 EUR
  • 710.40 EUR
  • 218.40 EUR
  • 376.80 EUR
  • 100 ul
  • 200 ul
  • 20 ul
  • 50 ul

Phospholipase A2, Group X (PLA2G10) Antibody

20-abx128169 Abbexa
  • 510.00 EUR
  • 159.60 EUR
  • 1446.00 EUR
  • 693.60 EUR
  • 393.60 EUR
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Phospholipase A2, Group X (PLA2G10) Antibody

20-abx301835 Abbexa
  • 493.20 EUR
  • 2214.00 EUR
  • 718.80 EUR
  • 218.40 EUR
  • 360.00 EUR
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Phospholipase A2, Group X (PLA2G10) Antibody

20-abx174048 Abbexa
  • 1028.40 EUR
  • 526.80 EUR
  • 1 mg
  • 200 ug

Recombinant Phospholipase A2, Group X (PLA2G10)

4-RPD833Hu01 Cloud-Clone
  • 601.69 EUR
  • 284.40 EUR
  • 1926.34 EUR
  • 722.11 EUR
  • 1324.22 EUR
  • 477.60 EUR
  • 4635.84 EUR
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Human Phospholipase A2, Group X expressed in: E.coli

Human Phospholipase A2, Group X (PLA2G10) Protein

20-abx167064 Abbexa
  • 844.80 EUR
  • 343.20 EUR
  • 2598.00 EUR
  • 994.80 EUR
  • 594.00 EUR
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Monkey Phospholipase A2, Group X (PLA2G10) ELISA Kit

abx360270-96tests Abbexa 96 tests 990 EUR

Pig Phospholipase A2, Group X (PLA2G10) ELISA Kit

abx362012-96tests Abbexa 96 tests 990 EUR

Rabbit Phospholipase A2, Group X (PLA2G10) ELISA Kit

abx362347-96tests Abbexa 96 tests 990 EUR

Chicken Phospholipase A2, Group X (PLA2G10) ELISA Kit

abx356098-96tests Abbexa 96 tests 990 EUR

Human Phospholipase A2, Group X (PLA2G10) CLIA Kit

abx197460-96tests Abbexa 96 tests 990 EUR

Human Phospholipase A2, Group X (PLA2G10) CLIA Kit

20-abx494408 Abbexa
  • 9567.60 EUR
  • 5095.20 EUR
  • 1177.20 EUR
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

ELISA kit for Human PLA2G10 (Phospholipase A2, Group X)

E-EL-H1011 Elabscience Biotech 1 plate of 96 wells 640.8 EUR
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G10 (Phospholipase A2, Group X) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Human PLA2G10 (Phospholipase A2, Group X)

ELK4236 ELK Biotech 1 plate of 96 wells 518.4 EUR
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group X from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Phospholipase A2, Group X (PLA2G10) Antibody (HRP)

20-abx315919 Abbexa
  • 493.20 EUR
  • 2214.00 EUR
  • 718.80 EUR
  • 218.40 EUR
  • 360.00 EUR
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Phospholipase A2, Group X (PLA2G10) Antibody (FITC)

20-abx315920 Abbexa
  • 493.20 EUR
  • 2214.00 EUR
  • 718.80 EUR
  • 218.40 EUR
  • 360.00 EUR
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Phospholipase A2, Group X (PLA2G10) Antibody (Biotin)

20-abx315921 Abbexa
  • 493.20 EUR
  • 2214.00 EUR
  • 718.80 EUR
  • 218.40 EUR
  • 360.00 EUR
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human)

4-PAD833Hu01 Cloud-Clone
  • 296.40 EUR
  • 3012.00 EUR
  • 750.00 EUR
  • 372.00 EUR
  • 256.80 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10)

CLIA kit for Human PLA2G10 (Phospholipase A2, Group X)

E-CL-H0681 Elabscience Biotech 1 plate of 96 wells 700.8 EUR
Description: A sandwich CLIA kit for quantitative measurement of Human PLA2G10 (Phospholipase A2, Group X) in samples from Serum, Plasma, Cell supernatant

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), APC

4-PAD833Hu01-APC Cloud-Clone
  • 414.00 EUR
  • 3930.00 EUR
  • 1094.40 EUR
  • 528.00 EUR
  • 262.80 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with APC.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), Biotinylated

4-PAD833Hu01-Biotin Cloud-Clone
  • 373.20 EUR
  • 2952.00 EUR
  • 872.40 EUR
  • 457.20 EUR
  • 262.80 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with Biotin.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), Cy3

4-PAD833Hu01-Cy3 Cloud-Clone
  • 502.80 EUR
  • 5190.00 EUR
  • 1410.00 EUR
  • 654.00 EUR
  • 301.20 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with Cy3.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), FITC

4-PAD833Hu01-FITC Cloud-Clone
  • 355.20 EUR
  • 3168.00 EUR
  • 900.00 EUR
  • 446.40 EUR
  • 234.00 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with FITC.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), HRP

4-PAD833Hu01-HRP Cloud-Clone
  • 379.20 EUR
  • 3426.00 EUR
  • 968.40 EUR
  • 477.60 EUR
  • 247.20 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with HRP.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), PE

4-PAD833Hu01-PE Cloud-Clone
  • 355.20 EUR
  • 3168.00 EUR
  • 900.00 EUR
  • 446.40 EUR
  • 234.00 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with PE.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), APC-Cy7

4-PAD833Hu01-APC-Cy7 Cloud-Clone
  • 685.20 EUR
  • 7716.00 EUR
  • 2046.00 EUR
  • 912.00 EUR
  • 382.80 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with APC-Cy7.

Human Group 10 secretory phospholipase A2(PLA2G10) ELISA kit

CSB-EL018085HU-24T Cusabio 1 plate of 24 wells 198 EUR
Description: Quantitativesandwich ELISA kit for measuring Human Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Group 10 secretory phospholipase A2(PLA2G10) ELISA kit

1-CSB-EL018085HU Cusabio
  • 964.80 EUR
  • 6118.80 EUR
  • 3244.80 EUR
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Human Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Human Group 10 secretory phospholipase A2, PLA2G10 ELISA KIT

ELI-37033h Lifescience Market 96 Tests 988.8 EUR

Mouse Group 10 secretory phospholipase A2(PLA2G10) ELISA kit

CSB-EL018085MO-24T Cusabio 1 plate of 24 wells 198 EUR
Description: Quantitativesandwich ELISA kit for measuring Mouse Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse Group 10 secretory phospholipase A2(PLA2G10) ELISA kit

1-CSB-EL018085MO Cusabio
  • 964.80 EUR
  • 6118.80 EUR
  • 3244.80 EUR
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Mouse Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Rat Group 10 secretory phospholipase A2(PLA2G10) ELISA kit

CSB-EL018085RA-24T Cusabio 1 plate of 24 wells 198 EUR
Description: Quantitativesandwich ELISA kit for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Rat Group 10 secretory phospholipase A2(PLA2G10) ELISA kit

1-CSB-EL018085RA Cusabio
  • 964.80 EUR
  • 6118.80 EUR
  • 3244.80 EUR
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Rat Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse Group 10 secretory phospholipase A2, Pla2g10 ELISA KIT

ELI-16162m Lifescience Market 96 Tests 1038 EUR

PLA2G10 Secreted Phospholipase A2-X Human Recombinant Protein

PROTO15496 BosterBio Regular: 10ug 380.4 EUR
Description: Secreted Phospholipase A2-X Human Recombinant is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag (underlined).;MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQ;PRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQE;LLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD.

ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10)

KTE100470-48T Abbkine 48T 398.4 EUR
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10)

KTE100470-5platesof96wells Abbkine 5 plates of 96 wells 2538 EUR
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10)

KTE100470-96T Abbkine 96T 646.8 EUR
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D)ELISA kit

201-12-2525 SunredBio 96 tests 528 EUR
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A)ELISA kit

201-12-2527 SunredBio 96 tests 528 EUR
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Phospholipase A2, Group IVD (PLA2G4D)ELISA kit

201-12-2529 SunredBio 96 tests 528 EUR
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B)ELISA kit

201-12-2530 SunredBio 96 tests 528 EUR
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

20-abx152759 Abbexa
  • 8853.60 EUR
  • 4719.60 EUR
  • 1093.20 EUR
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

20-abx152760 Abbexa
  • 8853.60 EUR
  • 4719.60 EUR
  • 1093.20 EUR
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

20-abx152761 Abbexa
  • 8534.40 EUR
  • 4550.40 EUR
  • 1054.80 EUR
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit

20-abx152762 Abbexa
  • 8853.60 EUR
  • 4719.60 EUR
  • 1093.20 EUR
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit

20-abx152763 Abbexa
  • 8853.60 EUR
  • 4719.60 EUR
  • 1093.20 EUR
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Phospholipase A2 Group VI (PLA2G6) ELISA Kit

abx253845-96tests Abbexa 96 tests 801.6 EUR

Human Group IIA phospholipase A2 (PLA2G2A) ELISA Kit

abx575929-96tests Abbexa 96 tests 886.8 EUR

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

DLR-PLA2G12B-Hu-48T DL Develop 48T 664.8 EUR
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

DLR-PLA2G12B-Hu-96T DL Develop 96T 870 EUR
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

DLR-PLA2G2A-Hu-48T DL Develop 48T 620.4 EUR
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

DLR-PLA2G2A-Hu-96T DL Develop 96T 807.6 EUR
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

DLR-PLA2G2D-Hu-48T DL Develop 48T 597.6 EUR
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

DLR-PLA2G2D-Hu-96T DL Develop 96T 776.4 EUR
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group III (PLA2G3) ELISA Kit

DLR-PLA2G3-Hu-48T DL Develop 48T 620.4 EUR
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids.

Human Phospholipase A2, Group III (PLA2G3) ELISA Kit

DLR-PLA2G3-Hu-96T DL Develop 96T 807.6 EUR
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit

DLR-PLA2G4D-Hu-48T DL Develop 48T 664.8 EUR
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit

DLR-PLA2G4D-Hu-96T DL Develop 96T 870 EUR
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from tissue homogenates or other biological fluids.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit

DLR-PLA2G5-Hu-48T DL Develop 48T 620.4 EUR
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit

DLR-PLA2G5-Hu-96T DL Develop 96T 807.6 EUR
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Group XVI phospholipase A2, PLA2G16 ELISA KIT

ELI-45167h Lifescience Market 96 Tests 988.8 EUR

Human Group XV phospholipase A2, PLA2G15 ELISA KIT

ELI-21820h Lifescience Market 96 Tests 988.8 EUR

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

SED827Hu-10x96wellstestplate Cloud-Clone 10x96-wells test plate 5677.8 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

SED827Hu-1x48wellstestplate Cloud-Clone 1x48-wells test plate 572.76 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

SED827Hu-1x96wellstestplate Cloud-Clone 1x96-wells test plate 766.8 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

SED827Hu-5x96wellstestplate Cloud-Clone 5x96-wells test plate 3090.6 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

4-SED827Hu Cloud-Clone
  • 5738.40 EUR
  • 3031.20 EUR
  • 768.00 EUR
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit

SED832Hu-10x96wellstestplate Cloud-Clone 10x96-wells test plate 5677.8 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit

SED832Hu-1x48wellstestplate Cloud-Clone 1x48-wells test plate 572.76 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit

SED832Hu-1x96wellstestplate Cloud-Clone 1x96-wells test plate 766.8 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit

SED832Hu-5x96wellstestplate Cloud-Clone 5x96-wells test plate 3090.6 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit

4-SED832Hu Cloud-Clone
  • 5738.40 EUR
  • 3031.20 EUR
  • 768.00 EUR
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit

SEM563Hu-10x96wellstestplate Cloud-Clone 10x96-wells test plate 6227.58 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit

SEM563Hu-1x48wellstestplate Cloud-Clone 1x48-wells test plate 618.04 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit

SEM563Hu-1x96wellstestplate Cloud-Clone 1x96-wells test plate 831.48 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit

SEM563Hu-5x96wellstestplate Cloud-Clone 5x96-wells test plate 3381.66 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit

4-SEM563Hu Cloud-Clone
  • 6288.00 EUR
  • 3322.80 EUR
  • 831.60 EUR
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

SEN729Hu-10x96wellstestplate Cloud-Clone 10x96-wells test plate 6227.58 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

SEN729Hu-1x48wellstestplate Cloud-Clone 1x48-wells test plate 618.04 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

SEN729Hu-1x96wellstestplate Cloud-Clone 1x96-wells test plate 831.48 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

SEN729Hu-5x96wellstestplate Cloud-Clone 5x96-wells test plate 3381.66 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

4-SEN729Hu Cloud-Clone
  • 6288.00 EUR
  • 3322.80 EUR
  • 831.60 EUR
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from Serum, plasma, tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

RD-PLA2G12B-Hu-48Tests Reddot Biotech 48 Tests 675.6 EUR

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

RD-PLA2G12B-Hu-96Tests Reddot Biotech 96 Tests 939.6 EUR

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

RD-PLA2G2A-Hu-48Tests Reddot Biotech 48 Tests 625.2 EUR

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

RD-PLA2G2A-Hu-96Tests Reddot Biotech 96 Tests 867.6 EUR

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

RD-PLA2G2D-Hu-48Tests Reddot Biotech 48 Tests 600 EUR

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

RD-PLA2G2D-Hu-96Tests Reddot Biotech 96 Tests 830.4 EUR

Human Phospholipase A2, Group III (PLA2G3) ELISA Kit

RD-PLA2G3-Hu-48Tests Reddot Biotech 48 Tests 625.2 EUR

Human Phospholipase A2, Group III (PLA2G3) ELISA Kit

RD-PLA2G3-Hu-96Tests Reddot Biotech 96 Tests 867.6 EUR

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit

RD-PLA2G4D-Hu-48Tests Reddot Biotech 48 Tests 675.6 EUR

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit

RD-PLA2G4D-Hu-96Tests Reddot Biotech 96 Tests 939.6 EUR

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit

RD-PLA2G5-Hu-48Tests Reddot Biotech 48 Tests 625.2 EUR

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit

RD-PLA2G5-Hu-96Tests Reddot Biotech 96 Tests 867.6 EUR

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

RDR-PLA2G12B-Hu-48Tests Reddot Biotech 48 Tests 706.8 EUR

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

RDR-PLA2G12B-Hu-96Tests Reddot Biotech 96 Tests 984 EUR

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

RDR-PLA2G2A-Hu-48Tests Reddot Biotech 48 Tests 652.8 EUR

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

RDR-PLA2G2A-Hu-96Tests Reddot Biotech 96 Tests 907.2 EUR

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

RDR-PLA2G2D-Hu-48Tests Reddot Biotech 48 Tests 626.4 EUR

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

RDR-PLA2G2D-Hu-96Tests Reddot Biotech 96 Tests 868.8 EUR

Human Phospholipase A2, Group III (PLA2G3) ELISA Kit

RDR-PLA2G3-Hu-48Tests Reddot Biotech 48 Tests 652.8 EUR

Human Phospholipase A2, Group III (PLA2G3) ELISA Kit

RDR-PLA2G3-Hu-96Tests Reddot Biotech 96 Tests 907.2 EUR

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit

RDR-PLA2G4D-Hu-48Tests Reddot Biotech 48 Tests 706.8 EUR

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit

RDR-PLA2G4D-Hu-96Tests Reddot Biotech 96 Tests 984 EUR

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit

RDR-PLA2G5-Hu-48Tests Reddot Biotech 48 Tests 652.8 EUR

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit

RDR-PLA2G5-Hu-96Tests Reddot Biotech 96 Tests 907.2 EUR

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

SEB077Hu-10x96wellstestplate Cloud-Clone 10x96-wells test plate 5402.92 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

SEB077Hu-1x48wellstestplate Cloud-Clone 1x48-wells test plate 550.13 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

SEB077Hu-1x96wellstestplate Cloud-Clone 1x96-wells test plate 734.46 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

SEB077Hu-5x96wellstestplate Cloud-Clone 5x96-wells test plate 2945.08 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

4-SEB077Hu Cloud-Clone
  • 5463.60 EUR
  • 2886.00 EUR
  • 735.60 EUR
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.

Human Phospholipase A2, Group XIIB(PLA2G12B)ELISA Kit

QY-E05175 Qayee Biotechnology 96T 433.2 EUR

Human Phospholipase A2, Group IVD(PLA2G4D)ELISA Kit

QY-E05205 Qayee Biotechnology 96T 433.2 EUR

Human Phospholipase A2, Group IID(PLA2G2D)ELISA Kit

QY-E05226 Qayee Biotechnology 96T 433.2 EUR

Human Phospholipase A2, Group IIA(PLA2G2A)ELISA Kit

QY-E05227 Qayee Biotechnology 96T 433.2 EUR

Human Phospholipase A2, Group IIA ELISA Kit (PLA2G2A)

RK02095 Abclonal 96 Tests 625.2 EUR

Human Phospholipase A2, Group IID ELISA Kit (PLA2G2D)

RK02096 Abclonal 96 Tests 625.2 EUR

Human Phospholipase A2, Group V ELISA Kit (PLA2G5)

RK02097 Abclonal 96 Tests 625.2 EUR

Phospholipase A2, Group Ive Antibody

20-abx114482 Abbexa
  • 878.40 EUR
  • 477.60 EUR
  • 150 ul
  • 50 ul

Phospholipase A2, Group Ivf Antibody

20-abx114483 Abbexa
  • 878.40 EUR
  • 477.60 EUR
  • 150 ul
  • 50 ul

Phospholipase A2, Group Xiia Antibody

20-abx114484 Abbexa
  • 878.40 EUR
  • 477.60 EUR
  • 150 ul
  • 50 ul

Phospholipase A2, Group Xiib Antibody

20-abx114485 Abbexa
  • 878.40 EUR
  • 477.60 EUR
  • 150 ul
  • 50 ul

Human Phospholipase A2 Group XII A (PLA2G12A) ELISA Kit

abx382266-96tests Abbexa 96 tests 1093.2 EUR

Human Phospholipase A2 Group IV B (PLA2G4B) ELISA Kit

abx382267-96tests Abbexa 96 tests 1093.2 EUR

Human Phospholipase A2 Group IV E (PLA2G4E) ELISA Kit

abx382268-96tests Abbexa 96 tests 1093.2 EUR

Human Phospholipase A2 Group IV F (PLA2G4E) ELISA Kit

20-abx382269 Abbexa
  • 8853.60 EUR
  • 4719.60 EUR
  • 1093.20 EUR
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Phospholipase A2, Group II A (PLA2G2A) ELISA Kit

abx251779-96tests Abbexa 96 tests 904.8 EUR

Human Phospholipase A2, Group XII B (PLA2G12B) ELISA Kit

abx252991-96tests Abbexa 96 tests 848.4 EUR

Human Phospholipase A2, Group IV D (PLA2G4D) ELISA Kit

abx252993-96tests Abbexa 96 tests 848.4 EUR

Human Phospholipase A2, Group II D (PLA2G2D) ELISA Kit

abx354458-96tests Abbexa 96 tests 848.4 EUR

Human Group XIIA secretory phospholipase A2(PLA2G12A) ELISA kit

CSB-EL018086HU-24T Cusabio 1 plate of 24 wells 198 EUR
Description: Quantitativecompetitive ELISA kit for measuring Human Group XIIA secretory phospholipase A2 (PLA2G12A) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Group XIIA secretory phospholipase A2(PLA2G12A) ELISA kit

1-CSB-EL018086HU Cusabio
  • 964.80 EUR
  • 6118.80 EUR
  • 3244.80 EUR
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativecompetitive ELISA kit for measuring Human Group XIIA secretory phospholipase A2(PLA2G12A) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Human Group IIF secretory phospholipase A2(PLA2G2F) ELISA kit

CSB-EL018095HU-24T Cusabio 1 plate of 24 wells 198 EUR
Description: Quantitativesandwich ELISA kit for measuring Human Group IIF secretory phospholipase A2 (PLA2G2F) in samples from serum, plasma, tissue, homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Group IIF secretory phospholipase A2(PLA2G2F) ELISA kit

1-CSB-EL018095HU Cusabio
  • 964.80 EUR
  • 6118.80 EUR
  • 3244.80 EUR
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Human Group IIF secretory phospholipase A2(PLA2G2F) in samples from serum, plasma, tissue, homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

ELISA kit for Human PLA2G12B (Phospholipase A2, Group ? B)

E-EL-H1029 Elabscience Biotech 1 plate of 96 wells 640.8 EUR
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G12B (Phospholipase A2, Group ? B) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Human PLA2G4D (Phospholipase A2, Group ? D)

E-EL-H1048 Elabscience Biotech 1 plate of 96 wells 640.8 EUR
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G4D (Phospholipase A2, Group ? D) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Human PLA2G2D (Phospholipase A2, Group IID)

ELK1754 ELK Biotech 1 plate of 96 wells 518.4 EUR
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group IID from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Human PLA2G2A (Phospholipase A2, Group IIA)

ELK3752 ELK Biotech 1 plate of 96 wells 518.4 EUR
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group IIA from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Human PLA2G12B(Phospholipase A2, Group XII B) ELISA Kit

EH3604 FN Test 96T 628.92 EUR
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.094 ng/ml

Human PLA2G4D(Phospholipase A2, Group IV D) ELISA Kit

EH3606 FN Test 96T 628.92 EUR
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.094 ng/ml

ELISA kit for Human PLA2G12B (Phospholipase A2, Group XIIB)

ELK6117 ELK Biotech 1 plate of 96 wells 518.4 EUR
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group XIIB from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Human PLA2G4D (Phospholipase A2, Group IVD)

ELK6188 ELK Biotech 1 plate of 96 wells 518.4 EUR
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group IVD from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Human PLA2G5 (Phospholipase A2, Group V)

ELK4777 ELK Biotech 1 plate of 96 wells 518.4 EUR
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group V from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Human Group IIF secretory phospholipase A2, PLA2G2F ELISA KIT

ELI-23295h Lifescience Market 96 Tests 988.8 EUR

Human Group IID secretory phospholipase A2, PLA2G2D ELISA KIT

ELI-45186h Lifescience Market 96 Tests 988.8 EUR

Human Group IIE secretory phospholipase A2, PLA2G2E ELISA KIT

ELI-35519h Lifescience Market 96 Tests 988.8 EUR

Human Group XIIA secretory phospholipase A2, PLA2G12A ELISA KIT

ELI-21567h Lifescience Market 96 Tests 988.8 EUR

Human Group 3 secretory phospholipase A2, PLA2G3 ELISA KIT

ELI-37656h Lifescience Market 96 Tests 988.8 EUR

ELISA kit for Human PLA2G2D (Phospholipase A2, Group ?D)

E-EL-H2384 Elabscience Biotech 1 plate of 96 wells 640.8 EUR
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G2D (Phospholipase A2, Group ?D) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Human PLA2G2A (Phospholipase A2, Group ?A)

E-EL-H2385 Elabscience Biotech 1 plate of 96 wells 640.8 EUR
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G2A (Phospholipase A2, Group ?A) in samples from Serum, Plasma, Cell supernatant

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

20-abx154554 Abbexa
  • 8853.60 EUR
  • 4719.60 EUR
  • 1093.20 EUR
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

20-abx154555 Abbexa
  • 8684.40 EUR
  • 4626.00 EUR
  • 1074.00 EUR
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit

20-abx154556 Abbexa
  • 8853.60 EUR
  • 4719.60 EUR
  • 1093.20 EUR
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

20-abx155982 Abbexa
  • 8684.40 EUR
  • 4626.00 EUR
  • 1074.00 EUR
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

abx254356-96tests Abbexa 96 tests 848.4 EUR

Mouse Phospholipase A2 Group VI (PLA2G6) ELISA Kit

abx512875-96tests Abbexa 96 tests 801.6 EUR

Rat Phospholipase A2 Group VI (PLA2G6) ELISA Kit

abx512877-96tests Abbexa 96 tests 801.6 EUR

Cow Group IIA phospholipase A2 (PLA2G2A) ELISA Kit

abx520902-96tests Abbexa 96 tests 1093.2 EUR

Rat Group IIA phospholipase A2 (PLA2G2A) ELISA Kit

abx572864-96tests Abbexa 96 tests 848.4 EUR

Mouse Group IIA phospholipase A2 (PLA2G2A) ELISA Kit

abx575023-96tests Abbexa 96 tests 886.8 EUR

Rat Group IIA phospholipase A2 (PLA2G2A) ELISA Kit

abx255942-96tests Abbexa 96 tests 848.4 EUR

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

DLR-PLA2G2A-Mu-48T DL Develop 48T 632.4 EUR
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

DLR-PLA2G2A-Mu-96T DL Develop 96T 825.6 EUR
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

DLR-PLA2G2A-Ra-48T DL Develop 48T 658.8 EUR
Description: A sandwich quantitative ELISA assay kit for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

DLR-PLA2G2A-Ra-96T DL Develop 96T 861.6 EUR
Description: A sandwich quantitative ELISA assay kit for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

DLR-PLA2G2D-Mu-48T DL Develop 48T 609.6 EUR
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids.

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

DLR-PLA2G2D-Mu-96T DL Develop 96T 793.2 EUR
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids.

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit

DLR-PLA2G3-Mu-48T DL Develop 48T 632.4 EUR
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids.

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit

DLR-PLA2G3-Mu-96T DL Develop 96T 825.6 EUR
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids.

Rat PLA2G2A(Phospholipase A2,Group IIA) ELISA Kit

ER1276 FN Test 96T 628.92 EUR
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Rattus;Sensitivity: 0.094 ng/ml

Mouse PLA2G2D(Phospholipase A2, Group IID) ELISA Kit

EM1297 FN Test 96T 628.92 EUR
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 18.75pg/ml

Mouse Group XVI phospholipase A2, Pla2g16 ELISA KIT

ELI-37775m Lifescience Market 96 Tests 1038 EUR

Bovine Group XV phospholipase A2, PLA2G15 ELISA KIT

ELI-14523b Lifescience Market 96 Tests 1113.6 EUR

Mouse Group XV phospholipase A2, Pla2g15 ELISA KIT

ELI-14703m Lifescience Market 96 Tests 1038 EUR

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

SED827Mu-10x96wellstestplate Cloud-Clone 10x96-wells test plate 5834.88 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

SED827Mu-1x48wellstestplate Cloud-Clone 1x48-wells test plate 585.7 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

SED827Mu-1x96wellstestplate Cloud-Clone 1x96-wells test plate 785.28 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

SED827Mu-5x96wellstestplate Cloud-Clone 5x96-wells test plate 3173.76 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

4-SED827Mu Cloud-Clone
  • 5895.60 EUR
  • 3114.00 EUR
  • 786.00 EUR
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

SED827Ra-10x96wellstestplate Cloud-Clone 10x96-wells test plate 6149.04 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

SED827Ra-1x48wellstestplate Cloud-Clone 1x48-wells test plate 611.57 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

SED827Ra-1x96wellstestplate Cloud-Clone 1x96-wells test plate 822.24 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

SED827Ra-5x96wellstestplate Cloud-Clone 5x96-wells test plate 3340.08 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

4-SED827Ra Cloud-Clone
  • 6210.00 EUR
  • 3280.80 EUR
  • 823.20 EUR
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in samples from Serum, plasma, tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit

SED831Mu-10x96wellstestplate Cloud-Clone 10x96-wells test plate 5834.88 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group III (PLA2G3) in serum, plasma and other biological fluids.

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit

SED831Mu-1x48wellstestplate Cloud-Clone 1x48-wells test plate 585.7 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group III (PLA2G3) in serum, plasma and other biological fluids.

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit

SED831Mu-1x96wellstestplate Cloud-Clone 1x96-wells test plate 785.28 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group III (PLA2G3) in serum, plasma and other biological fluids.

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit

SED831Mu-5x96wellstestplate Cloud-Clone 5x96-wells test plate 3173.76 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group III (PLA2G3) in serum, plasma and other biological fluids.

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit

4-SED831Mu Cloud-Clone
  • 5895.60 EUR
  • 3114.00 EUR
  • 786.00 EUR
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Phospholipase A2, Group III (PLA2G3) in samples from Serum, plasma and other biological fluids. with no significant corss-reactivity with analogues from other species.

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

RD-PLA2G2A-Mu-48Tests Reddot Biotech 48 Tests 639.6 EUR

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

RD-PLA2G2A-Mu-96Tests Reddot Biotech 96 Tests 888 EUR

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

RD-PLA2G2A-Ra-48Tests Reddot Biotech 48 Tests 668.4 EUR

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

RD-PLA2G2A-Ra-96Tests Reddot Biotech 96 Tests 930 EUR

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

RD-PLA2G2D-Mu-48Tests Reddot Biotech 48 Tests 613.2 EUR

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

RD-PLA2G2D-Mu-96Tests Reddot Biotech 96 Tests 850.8 EUR

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit

RD-PLA2G3-Mu-48Tests Reddot Biotech 48 Tests 639.6 EUR

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit

RD-PLA2G3-Mu-96Tests Reddot Biotech 96 Tests 888 EUR

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

RDR-PLA2G2A-Mu-48Tests Reddot Biotech 48 Tests 668.4 EUR

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

RDR-PLA2G2A-Mu-96Tests Reddot Biotech 96 Tests 928.8 EUR

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

RDR-PLA2G2A-Ra-48Tests Reddot Biotech 48 Tests 699.6 EUR

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

RDR-PLA2G2A-Ra-96Tests Reddot Biotech 96 Tests 973.2 EUR

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

RDR-PLA2G2D-Mu-48Tests Reddot Biotech 48 Tests 640.8 EUR

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

RDR-PLA2G2D-Mu-96Tests Reddot Biotech 96 Tests 890.4 EUR

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit

RDR-PLA2G3-Mu-48Tests Reddot Biotech 48 Tests 668.4 EUR

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit

RDR-PLA2G3-Mu-96Tests Reddot Biotech 96 Tests 928.8 EUR

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

SEB077Mu-10x96wellstestplate Cloud-Clone 10x96-wells test plate 5552.14 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

SEB077Mu-1x48wellstestplate Cloud-Clone 1x48-wells test plate 562.42 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

SEB077Mu-1x96wellstestplate Cloud-Clone 1x96-wells test plate 752.02 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

SEB077Mu-5x96wellstestplate Cloud-Clone 5x96-wells test plate 3024.07 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

4-SEB077Mu Cloud-Clone
  • 5612.40 EUR
  • 2965.20 EUR
  • 752.40 EUR
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in samples from Serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.

Rat Phospholipase A2, Group IIA(PLA2G2A)ELISA Kit

QY-E10194 Qayee Biotechnology 96T 433.2 EUR

Rat Phospholipase A2(Group IVD(PLA2G4D)ELISA kit

QY-E10542 Qayee Biotechnology 96T 495.6 EUR

Rat Phospholipase A2(Group IID(PLA2G2D)ELISA kit

QY-E10543 Qayee Biotechnology 96T 495.6 EUR

Mouse Phospholipase A2(Group IID(PLA2G2D)ELISA kit

QY-E21172 Qayee Biotechnology 96T 433.2 EUR

Mouse Phospholipase A2(Group IVD(PLA2G4D)ELISA kit

QY-E21173 Qayee Biotechnology 96T 433.2 EUR

Mouse Phospholipase A2, Group IIA(PLA2G2A)ELISA Kit

QY-E21175 Qayee Biotechnology 96T 433.2 EUR

Recombinant Human Secreted Phospholipase A2-X

7-03355 CHI Scientific 2µg Ask for price

Recombinant Human Secreted Phospholipase A2-X

7-03356 CHI Scientific 10µg Ask for price

Recombinant Human Secreted Phospholipase A2-X

7-03357 CHI Scientific 1mg Ask for price

Human Phospholipase A2, Group IVD (PLA2G4D) CLIA Kit

20-abx496066 Abbexa
  • 10282.80 EUR
  • 5472.00 EUR
  • 1262.40 EUR
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Phospholipase A2, Group XIIB (PLA2G12B) CLIA Kit

20-abx496107 Abbexa
  • 10282.80 EUR
  • 5472.00 EUR
  • 1262.40 EUR
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Phospholipase A2, Group IIA (PLA2G2A) CLIA Kit

20-abx494403 Abbexa
  • 9567.60 EUR
  • 5095.20 EUR
  • 1177.20 EUR
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Phospholipase A2, Group V (PLA2G5) CLIA Kit

20-abx494407 Abbexa
  • 9567.60 EUR
  • 5095.20 EUR
  • 1177.20 EUR
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Phospholipase A2, Group IID (PLA2G2D) CLIA Kit

20-abx492390 Abbexa
  • 9567.60 EUR
  • 5095.20 EUR
  • 1177.20 EUR
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Secreted Phospholipase A2-X (Recombinant)

20-abx073638 Abbexa
  • 393.60 EUR
  • 6373.20 EUR
  • 276.00 EUR
  • 10 ug
  • 1 mg
  • 2 µg

Human Phospholipase A2, Group IIA (PLA2G2A) Protein

20-abx166841 Abbexa
  • 811.20 EUR
  • 343.20 EUR
  • 2498.40 EUR
  • 961.20 EUR
  • 577.20 EUR
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Human Phospholipase A2, Group III (PLA2G3) Protein

20-abx650483 Abbexa
  • 844.80 EUR
  • 343.20 EUR
  • 2598.00 EUR
  • 994.80 EUR
  • 594.00 EUR
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Human Phospholipase A2, Group XII (PLA2G12) Protein

20-abx650485 Abbexa
  • 844.80 EUR
  • 343.20 EUR
  • 2631.60 EUR
  • 1011.60 EUR
  • 610.80 EUR
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Human Phospholipase A2, Group IVD (PLA2G4D) Protein

20-abx650806 Abbexa
  • 777.60 EUR
  • 326.40 EUR
  • 2331.60 EUR
  • 910.80 EUR
  • 560.40 EUR
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Human Phospholipase A2, Group IID (PLA2G2D) Protein

20-abx654724 Abbexa
  • 693.60 EUR
  • 309.60 EUR
  • 2064.00 EUR
  • 828.00 EUR
  • 510.00 EUR
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Human Phospholipase A2, Group V (PLA2G5) Protein

20-abx654728 Abbexa
  • 693.60 EUR
  • 309.60 EUR
  • 2064.00 EUR
  • 828.00 EUR
  • 510.00 EUR
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Human Phospholipase A2, Group XIIB (PLA2G12B) Protein

20-abx654729 Abbexa
  • 693.60 EUR
  • 309.60 EUR
  • 2064.00 EUR
  • 828.00 EUR
  • 510.00 EUR
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Human Group IID secretory phospholipase A2 (PLA2G2D)

1-CSB-EP891566HU Cusabio
  • 456.00 EUR
  • 256.80 EUR
  • 1570.80 EUR
  • 672.00 EUR
  • 1047.60 EUR
  • 314.40 EUR
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
Description: Recombinant Human Group IID secretory phospholipase A2(PLA2G2D),partial expressed in E.coli

Human Group XIIA secretory phospholipase A2 (PLA2G12A)

1-CSB-YP863638HU Cusabio
  • 516.00 EUR
  • 280.80 EUR
  • 1809.60 EUR
  • 770.40 EUR
  • 1210.80 EUR
  • 349.20 EUR
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
Description: Recombinant Human Group XIIA secretory phospholipase A2(PLA2G12A),partial expressed in Yeast

Phospholipase A2 Group IVC (PLA2G4C) Antibody

20-abx134069 Abbexa
  • 360.00 EUR
  • 526.80 EUR
  • 226.80 EUR
  • 100 ul
  • 200 ul
  • 30 ul

Phospholipase A2, Group IIA (PLA2G2A) Antibody

20-abx103197 Abbexa
  • 543.60 EUR
  • 159.60 EUR
  • 1562.40 EUR
  • 744.00 EUR
  • 410.40 EUR
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Phospholipase A2, Group IID (PLA2G2D) Antibody

20-abx103198 Abbexa
  • 360.00 EUR
  • 159.60 EUR
  • 961.20 EUR
  • 510.00 EUR
  • 309.60 EUR
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Phospholipase A2 Group IVC (PLA2G4C) Antibody

20-abx006526 Abbexa
  • 493.20 EUR
  • 710.40 EUR
  • 218.40 EUR
  • 376.80 EUR
  • 100 ul
  • 200 ul
  • 20 ul
  • 50 ul

Phospholipase A2 Group VI (PLA2G6) Antibody

20-abx124080 Abbexa
  • 493.20 EUR
  • 710.40 EUR
  • 218.40 EUR
  • 376.80 EUR
  • 100 ul
  • 200 ul
  • 20 ul
  • 50 ul

Phospholipase A2, Group IID (PLA2G2D) Antibody

20-abx130118 Abbexa
  • 526.80 EUR
  • 159.60 EUR
  • 1479.60 EUR
  • 710.40 EUR
  • 393.60 EUR
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Phospholipase A2, Group IVD (PLA2G4D) Antibody

20-abx130913 Abbexa
  • 543.60 EUR
  • 159.60 EUR
  • 1579.20 EUR
  • 744.00 EUR
  • 410.40 EUR
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Phospholipase A2, Group III (PLA2G3) Antibody

20-abx131085 Abbexa
  • 393.60 EUR
  • 159.60 EUR
  • 1045.20 EUR
  • 543.60 EUR
  • 326.40 EUR
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Phospholipase A2, Group III (PLA2G3) Antibody

20-abx131086 Abbexa
  • 510.00 EUR
  • 159.60 EUR
  • 1446.00 EUR
  • 693.60 EUR
  • 393.60 EUR
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Phospholipase A2, Group XII (PLA2G12) Antibody

20-abx131471 Abbexa
  • 526.80 EUR
  • 159.60 EUR
  • 1479.60 EUR
  • 710.40 EUR
  • 393.60 EUR
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Phospholipase A2, Group XII (PLA2G12) Antibody

20-abx131472 Abbexa
  • 510.00 EUR
  • 159.60 EUR
  • 1446.00 EUR
  • 693.60 EUR
  • 393.60 EUR
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Phospholipase A2, Group IIA (PLA2G2A) Antibody

20-abx128864 Abbexa
  • 510.00 EUR
  • 159.60 EUR
  • 1446.00 EUR
  • 693.60 EUR
  • 393.60 EUR
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Phospholipase A2, Group Ivd (Cytosolic) Antibody

20-abx114481 Abbexa
  • 878.40 EUR
  • 477.60 EUR
  • 150 ul
  • 50 ul

Phospholipase A2 Group IVC (PLA2G4C) Antibody

20-abx014417 Abbexa
  • 376.80 EUR
  • 117.60 EUR
  • 477.60 EUR
  • 594.00 EUR
  • 100 ug
  • 10 ug
  • 200 ug
  • 300 µg

Phospholipase A2, Group V (PLA2G5) Antibody

abx028287-400ul Abbexa 400 ul 627.6 EUR

Phospholipase A2, Group V (PLA2G5) Antibody

abx028287-80l Abbexa 80 µl 343.2 EUR

Phospholipase A2, Group III (PLA2G3) Antibody

abx030609-400ul Abbexa 400 ul 627.6 EUR

Phospholipase A2, Group III (PLA2G3) Antibody

abx030609-80l Abbexa 80 µl 343.2 EUR

Phospholipase A2 Group IVC (PLA2G4C) Antibody

20-abx321000 Abbexa
  • 526.80 EUR
  • 393.60 EUR
  • 100 ul
  • 50 ul

Phospholipase A2 Group IVC (PLA2G4C) Antibody

20-abx322485 Abbexa
  • 526.80 EUR
  • 393.60 EUR
  • 100 ul
  • 50 ul

Phospholipase A2, Group IVD (PLA2G4D) Antibody

20-abx323008 Abbexa
  • 376.80 EUR
  • 292.80 EUR
  • 100 ug
  • 50 ug

Phospholipase A2 Group IVC (PLA2G4C) Antibody

abx331099-100ul Abbexa 100 ul 510 EUR

Phospholipase A2 Group IVC (PLA2G4C) Antibody

20-abx323686 Abbexa
  • 376.80 EUR
  • 292.80 EUR
  • 100 ug
  • 50 ug

Phospholipase A2 Group VI (PLA2G6) Antibody

20-abx327999 Abbexa
  • 376.80 EUR
  • 292.80 EUR
  • 100 ug
  • 50 ug

Phospholipase A2 Group IVC (PLA2G4C) Antibody

abx433141-200ul Abbexa 200 ul 460.8 EUR

Phospholipase A2, Group IIA (PLA2G2A) Antibody

20-abx174043 Abbexa
  • 1028.40 EUR
  • 526.80 EUR
  • 1 mg
  • 200 ug

Phospholipase A2, Group IIA (PLA2G2A) Antibody

20-abx174044 Abbexa
  • 1095.60 EUR
  • 560.40 EUR
  • 1 mg
  • 200 ug