Human PLA2G10(Phospholipase A2, Group X) ELISA Kit
To Order Contact us: michael@lotusbiotechnologies.com
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
RD-PLA2G10-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 521 |
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
RD-PLA2G10-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 723 |
Human Phospholipase A2, Group X (PLA2G10)ELISA kit |
201-12-2526 |
SunredBio |
96 tests |
EUR 440 |
- This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
|
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
20-abx152758 |
Abbexa |
-
EUR 7378.00
-
EUR 3933.00
-
EUR 911.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-7 working days.
|
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
abx252990-96tests |
Abbexa |
96 tests |
EUR 668 |
- Shipped within 5-12 working days.
|
Human PLA2G10(Phospholipase A2, Group X) ELISA Kit |
EH3603 |
FN Test |
96T |
EUR 524.1 |
- Detection range: 7.813-500 pg/ml
- Uniprot ID: O15496
- Alias: PLA2G10
|
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 4.688pg/ml |
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
SED833Hu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4731.5 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group X (PLA2G10) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay:
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids. |
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
SED833Hu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 477.3 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group X (PLA2G10) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay:
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids. |
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
SED833Hu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 639 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group X (PLA2G10) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay:
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids. |
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
SED833Hu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2575.5 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group X (PLA2G10) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay:
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids. |
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
4-SED833Hu |
Cloud-Clone |
-
EUR 4782.00
-
EUR 2526.00
-
EUR 640.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
- Known also as Phospholipase A2, Group X elisa. Alternative names of the recognized antigen: GXPLA2
- GX sPLA2
- sPLA2-X
- Group 10 secretory phospholipase A2
- Phosphatidylcholine 2-acylhydrolase 10
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group X (PLA2G10) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species. |
Phospholipase A2, Group X (PLA2G10) Antibody |
20-abx126373 |
Abbexa |
-
EUR 411.00
-
EUR 592.00
-
EUR 182.00
-
EUR 314.00
|
-
100 ul
-
200 ul
-
20 ul
-
50 ul
|
- Shipped within 5-10 working days.
|
Phospholipase A2, Group X (PLA2G10) Antibody |
20-abx128169 |
Abbexa |
-
EUR 425.00
-
EUR 133.00
-
EUR 1205.00
-
EUR 578.00
-
EUR 328.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Phospholipase A2, Group X (PLA2G10) Antibody |
20-abx174048 |
Abbexa |
|
|
|
Phospholipase A2, Group X (PLA2G10) Antibody |
20-abx301835 |
Abbexa |
-
EUR 411.00
-
EUR 1845.00
-
EUR 599.00
-
EUR 182.00
-
EUR 300.00
|
-
100 ug
-
1 mg
-
200 ug
-
20 ug
-
50 ug
|
- Shipped within 5-10 working days.
|
Recombinant Phospholipase A2, Group X (PLA2G10) |
4-RPD833Hu01 |
Cloud-Clone |
-
EUR 501.41
-
EUR 237.00
-
EUR 1605.28
-
EUR 601.76
-
EUR 1103.52
-
EUR 398.00
-
EUR 3863.20
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: O15496
- Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): 18.7KDa
- Isoelectric Point: Inquire
|
Description: Recombinant Human Phospholipase A2, Group X expressed in: E.coli |
Human Phospholipase A2, Group X (PLA2G10) Protein |
20-abx167064 |
Abbexa |
-
EUR 704.00
-
EUR 286.00
-
EUR 2165.00
-
EUR 829.00
-
EUR 495.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Monkey Phospholipase A2, Group X (PLA2G10) ELISA Kit |
abx360270-96tests |
Abbexa |
96 tests |
EUR 825 |
- Shipped within 5-12 working days.
|
Pig Phospholipase A2, Group X (PLA2G10) ELISA Kit |
abx362012-96tests |
Abbexa |
96 tests |
EUR 825 |
- Shipped within 5-12 working days.
|
Rabbit Phospholipase A2, Group X (PLA2G10) ELISA Kit |
abx362347-96tests |
Abbexa |
96 tests |
EUR 825 |
- Shipped within 5-12 working days.
|
Chicken Phospholipase A2, Group X (PLA2G10) ELISA Kit |
abx356098-96tests |
Abbexa |
96 tests |
EUR 825 |
- Shipped within 5-12 working days.
|
Human Phospholipase A2, Group X (PLA2G10) CLIA Kit |
abx197460-96tests |
Abbexa |
96 tests |
EUR 825 |
- Shipped within 5-12 working days.
|
Human Phospholipase A2, Group X (PLA2G10) CLIA Kit |
20-abx494408 |
Abbexa |
-
EUR 7973.00
-
EUR 4246.00
-
EUR 981.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
ELISA kit for Human PLA2G10 (Phospholipase A2, Group X) |
E-EL-H1011 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 534 |
- Gentaur's PLA2G10 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human PLA2G10. Standards or samples are added to the micro ELISA plate wells and combined w
- Show more
|
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G10 (Phospholipase A2, Group X) in samples from Serum, Plasma, Cell supernatant |
ELISA kit for Human PLA2G10 (Phospholipase A2, Group X) |
ELK4236 |
ELK Biotech |
1 plate of 96 wells |
EUR 432 |
- The microtiter plate provided in this kit has been pre-coated with an antibody specific to Phospholipase A2, Group X (PLA2G10). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific t
- Show more
|
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group X from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
Phospholipase A2, Group X (PLA2G10) Antibody (HRP) |
20-abx315919 |
Abbexa |
-
EUR 411.00
-
EUR 1845.00
-
EUR 599.00
-
EUR 182.00
-
EUR 300.00
|
-
100 ug
-
1 mg
-
200 ug
-
20 ug
-
50 ug
|
- Shipped within 5-10 working days.
|
Phospholipase A2, Group X (PLA2G10) Antibody (FITC) |
20-abx315920 |
Abbexa |
-
EUR 411.00
-
EUR 1845.00
-
EUR 599.00
-
EUR 182.00
-
EUR 300.00
|
-
100 ug
-
1 mg
-
200 ug
-
20 ug
-
50 ug
|
- Shipped within 5-10 working days.
|
Phospholipase A2, Group X (PLA2G10) Antibody (Biotin) |
20-abx315921 |
Abbexa |
-
EUR 411.00
-
EUR 1845.00
-
EUR 599.00
-
EUR 182.00
-
EUR 300.00
|
-
100 ug
-
1 mg
-
200 ug
-
20 ug
-
50 ug
|
- Shipped within 5-10 working days.
|
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human) |
4-PAD833Hu01 |
Cloud-Clone |
-
EUR 247.00
-
EUR 2510.00
-
EUR 625.00
-
EUR 310.00
-
EUR 214.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: PLA2G10 (Glu32~Asp165)
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10) |
CLIA kit for Human PLA2G10 (Phospholipase A2, Group X) |
E-CL-H0681 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 584 |
- Gentaur's PLA2G10 CLIA kit utilizes the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Human PLA2G10 . Standards or samples are added to the micro CLIA plate wells and combined wit
- Show more
|
Description: A sandwich CLIA kit for quantitative measurement of Human PLA2G10 (Phospholipase A2, Group X) in samples from Serum, Plasma, Cell supernatant |
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), APC |
4-PAD833Hu01-APC |
Cloud-Clone |
-
EUR 345.00
-
EUR 3275.00
-
EUR 912.00
-
EUR 440.00
-
EUR 219.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: PLA2G10 (Glu32~Asp165)
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with APC. |
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), Biotinylated |
4-PAD833Hu01-Biotin |
Cloud-Clone |
-
EUR 311.00
-
EUR 2460.00
-
EUR 727.00
-
EUR 381.00
-
EUR 219.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: PLA2G10 (Glu32~Asp165)
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with Biotin. |
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), Cy3 |
4-PAD833Hu01-Cy3 |
Cloud-Clone |
-
EUR 419.00
-
EUR 4325.00
-
EUR 1175.00
-
EUR 545.00
-
EUR 251.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: PLA2G10 (Glu32~Asp165)
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with Cy3. |
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), FITC |
4-PAD833Hu01-FITC |
Cloud-Clone |
-
EUR 296.00
-
EUR 2640.00
-
EUR 750.00
-
EUR 372.00
-
EUR 195.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: PLA2G10 (Glu32~Asp165)
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with FITC. |
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), HRP |
4-PAD833Hu01-HRP |
Cloud-Clone |
-
EUR 316.00
-
EUR 2855.00
-
EUR 807.00
-
EUR 398.00
-
EUR 206.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: PLA2G10 (Glu32~Asp165)
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with HRP. |
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), PE |
4-PAD833Hu01-PE |
Cloud-Clone |
-
EUR 296.00
-
EUR 2640.00
-
EUR 750.00
-
EUR 372.00
-
EUR 195.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: PLA2G10 (Glu32~Asp165)
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with PE. |
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), APC-Cy7 |
4-PAD833Hu01-APC-Cy7 |
Cloud-Clone |
-
EUR 571.00
-
EUR 6430.00
-
EUR 1705.00
-
EUR 760.00
-
EUR 319.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: PLA2G10 (Glu32~Asp165)
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with APC-Cy7. |
Human Group 10 secretory phospholipase A2(PLA2G10) ELISA kit |
CSB-EL018085HU-24T |
Cusabio |
1 plate of 24 wells |
EUR 165 |
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Human Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Human Group 10 secretory phospholipase A2(PLA2G10) ELISA kit |
1-CSB-EL018085HU |
Cusabio |
-
EUR 804.00
-
EUR 5099.00
-
EUR 2704.00
|
-
1 plate of 96 wells
-
10 plates of 96 wells each
-
5 plates of 96 wells each
|
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Human Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Human Group 10 secretory phospholipase A2, PLA2G10 ELISA KIT |
ELI-37033h |
Lifescience Market |
96 Tests |
EUR 824 |
Mouse Group 10 secretory phospholipase A2(PLA2G10) ELISA kit |
CSB-EL018085MO-24T |
Cusabio |
1 plate of 24 wells |
EUR 165 |
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Mouse Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Mouse Group 10 secretory phospholipase A2(PLA2G10) ELISA kit |
1-CSB-EL018085MO |
Cusabio |
-
EUR 804.00
-
EUR 5099.00
-
EUR 2704.00
|
-
1 plate of 96 wells
-
10 plates of 96 wells each
-
5 plates of 96 wells each
|
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Mouse Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Rat Group 10 secretory phospholipase A2(PLA2G10) ELISA kit |
CSB-EL018085RA-24T |
Cusabio |
1 plate of 24 wells |
EUR 165 |
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Rat Group 10 secretory phospholipase A2(PLA2G10) ELISA kit |
1-CSB-EL018085RA |
Cusabio |
-
EUR 804.00
-
EUR 5099.00
-
EUR 2704.00
|
-
1 plate of 96 wells
-
10 plates of 96 wells each
-
5 plates of 96 wells each
|
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Rat Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Mouse Group 10 secretory phospholipase A2, Pla2g10 ELISA KIT |
ELI-16162m |
Lifescience Market |
96 Tests |
EUR 865 |
PLA2G10 Secreted Phospholipase A2-X Human Recombinant Protein |
PROTO15496 |
BosterBio |
Regular: 10ug |
EUR 317 |
Description: Secreted Phospholipase A2-X Human Recombinant is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag (underlined).;MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQ;PRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQE;LLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD. |
ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10) |
KTE100470-48T |
Abbkine |
48T |
EUR 332 |
- The A2 phospholipases (PLA2s
- EC 3.1.1.4) catalyze the release of fatty acids from phospholipids and play a role in a wide range of physiologic functions. Cupillard et al. (1997) cloned a novel secretory PLA2, termed GXSPLA2, from a human fetal lung
- Show more
|
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10) |
KTE100470-5platesof96wells |
Abbkine |
5 plates of 96 wells |
EUR 2115 |
- The A2 phospholipases (PLA2s
- EC 3.1.1.4) catalyze the release of fatty acids from phospholipids and play a role in a wide range of physiologic functions. Cupillard et al. (1997) cloned a novel secretory PLA2, termed GXSPLA2, from a human fetal lung
- Show more
|
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10) |
KTE100470-96T |
Abbkine |
96T |
EUR 539 |
- The A2 phospholipases (PLA2s
- EC 3.1.1.4) catalyze the release of fatty acids from phospholipids and play a role in a wide range of physiologic functions. Cupillard et al. (1997) cloned a novel secretory PLA2, termed GXSPLA2, from a human fetal lung
- Show more
|
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
Human Phospholipase A2, Group IID (PLA2G2D)ELISA kit |
201-12-2525 |
SunredBio |
96 tests |
EUR 440 |
- This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
|
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
Human Phospholipase A2, Group IIA (PLA2G2A)ELISA kit |
201-12-2527 |
SunredBio |
96 tests |
EUR 440 |
- This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
|
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
Human Phospholipase A2, Group IVD (PLA2G4D)ELISA kit |
201-12-2529 |
SunredBio |
96 tests |
EUR 440 |
- This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
|
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
Human Phospholipase A2, Group XIIB (PLA2G12B)ELISA kit |
201-12-2530 |
SunredBio |
96 tests |
EUR 440 |
- This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
|
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
DLR-PLA2G12B-Hu-48T |
DL Develop |
48T |
EUR 554 |
- Should the Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
DLR-PLA2G12B-Hu-96T |
DL Develop |
96T |
EUR 725 |
- Should the Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
DLR-PLA2G2A-Hu-48T |
DL Develop |
48T |
EUR 517 |
- Should the Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
DLR-PLA2G2A-Hu-96T |
DL Develop |
96T |
EUR 673 |
- Should the Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
DLR-PLA2G2D-Hu-48T |
DL Develop |
48T |
EUR 498 |
- Should the Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
DLR-PLA2G2D-Hu-96T |
DL Develop |
96T |
EUR 647 |
- Should the Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit |
DLR-PLA2G3-Hu-48T |
DL Develop |
48T |
EUR 517 |
- Should the Human Phospholipase A2, Group III (PLA2G3) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids. |
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit |
DLR-PLA2G3-Hu-96T |
DL Develop |
96T |
EUR 673 |
- Should the Human Phospholipase A2, Group III (PLA2G3) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids. |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
DLR-PLA2G4D-Hu-48T |
DL Develop |
48T |
EUR 554 |
- Should the Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from tissue homogenates or other biological fluids. |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
DLR-PLA2G4D-Hu-96T |
DL Develop |
96T |
EUR 725 |
- Should the Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from tissue homogenates or other biological fluids. |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
DLR-PLA2G5-Hu-48T |
DL Develop |
48T |
EUR 517 |
- Should the Human Phospholipase A2, Group V (PLA2G5) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
DLR-PLA2G5-Hu-96T |
DL Develop |
96T |
EUR 673 |
- Should the Human Phospholipase A2, Group V (PLA2G5) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
20-abx152759 |
Abbexa |
-
EUR 7378.00
-
EUR 3933.00
-
EUR 911.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-7 working days.
|
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
20-abx152760 |
Abbexa |
-
EUR 7378.00
-
EUR 3933.00
-
EUR 911.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-7 working days.
|
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
20-abx152761 |
Abbexa |
-
EUR 7112.00
-
EUR 3792.00
-
EUR 879.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-7 working days.
|
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
20-abx152762 |
Abbexa |
-
EUR 7378.00
-
EUR 3933.00
-
EUR 911.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-7 working days.
|
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
20-abx152763 |
Abbexa |
-
EUR 7378.00
-
EUR 3933.00
-
EUR 911.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-7 working days.
|
Human Phospholipase A2 Group VI (PLA2G6) ELISA Kit |
abx253845-96tests |
Abbexa |
96 tests |
EUR 668 |
- Shipped within 5-12 working days.
|
Human Group XV phospholipase A2, PLA2G15 ELISA KIT |
ELI-21820h |
Lifescience Market |
96 Tests |
EUR 824 |
Human Group XVI phospholipase A2, PLA2G16 ELISA KIT |
ELI-45167h |
Lifescience Market |
96 Tests |
EUR 824 |
Human Group IIA phospholipase A2 (PLA2G2A) ELISA Kit |
abx575929-96tests |
Abbexa |
96 tests |
EUR 739 |
- Shipped within 5-12 working days.
|
Human Phospholipase A2, Group XIIB(PLA2G12B)ELISA Kit |
QY-E05175 |
Qayee Biotechnology |
96T |
EUR 361 |
Human Phospholipase A2, Group IIA ELISA Kit (PLA2G2A) |
RK02095 |
Abclonal |
96 Tests |
EUR 521 |
Human Phospholipase A2, Group IID ELISA Kit (PLA2G2D) |
RK02096 |
Abclonal |
96 Tests |
EUR 521 |
Human Phospholipase A2, Group V ELISA Kit (PLA2G5) |
RK02097 |
Abclonal |
96 Tests |
EUR 521 |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
SED827Hu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4731.5 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
SED827Hu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 477.3 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
SED827Hu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 639 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
SED827Hu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2575.5 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
4-SED827Hu |
Cloud-Clone |
-
EUR 4782.00
-
EUR 2526.00
-
EUR 640.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
- Known also as Phospholipase A2, Group IIA elisa. Alternative names of the recognized antigen: PLA2
- MOM1
- PLA2B
- PLA2L
- PLA2S
- PLAS1
- sPLA2(platelets, synovial fluid)
- Non-pancreatic secretory phospholipase A2
- Phosphatidylcholine 2-acylhydrolase 2A
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species. |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
SED832Hu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4731.5 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group V (PLA2G5) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: C
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
SED832Hu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 477.3 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group V (PLA2G5) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: C
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
SED832Hu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 639 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group V (PLA2G5) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: C
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
SED832Hu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2575.5 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group V (PLA2G5) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: C
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
4-SED832Hu |
Cloud-Clone |
-
EUR 4782.00
-
EUR 2526.00
-
EUR 640.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
- Known also as Phospholipase A2, Group V elisa. Alternative names of the recognized antigen: PLA2-10
- Calcium-dependent phospholipase A2
- Group V phospholipase A2
- Phosphatidylcholine 2-acylhydrolase 5
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species. |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
SEB077Hu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4502.43 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IID (PLA2G2D) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
SEB077Hu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 458.44 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IID (PLA2G2D) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
SEB077Hu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 612.05 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IID (PLA2G2D) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
SEB077Hu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2454.23 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IID (PLA2G2D) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
4-SEB077Hu |
Cloud-Clone |
-
EUR 4553.00
-
EUR 2405.00
-
EUR 613.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
- Known also as Phospholipase A2, Group IID elisa. Alternative names of the recognized antigen: PLA2G2D
- sPLA2S
- s-PLA2
- sPLA2
- SPLASH
- Secreted Phospholipase A2
- Phosphatidylcholine 2-acylhydrolase 2D
- Secretory-type PLA, stroma-associated homolog
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species. |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
RDR-PLA2G12B-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 589 |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
RDR-PLA2G12B-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 820 |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
RDR-PLA2G2A-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 544 |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
RDR-PLA2G2A-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 756 |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
RDR-PLA2G2D-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 522 |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
RDR-PLA2G2D-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 724 |
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit |
RDR-PLA2G3-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 544 |
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit |
RDR-PLA2G3-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 756 |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
RDR-PLA2G4D-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 589 |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
RDR-PLA2G4D-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 820 |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
RDR-PLA2G5-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 544 |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
RDR-PLA2G5-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 756 |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
RD-PLA2G12B-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 563 |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
RD-PLA2G12B-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 783 |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
RD-PLA2G2A-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 521 |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
RD-PLA2G2A-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 723 |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
RD-PLA2G2D-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 500 |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
RD-PLA2G2D-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 692 |
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit |
RD-PLA2G3-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 521 |
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit |
RD-PLA2G3-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 723 |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
RD-PLA2G4D-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 563 |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
RD-PLA2G4D-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 783 |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
RD-PLA2G5-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 521 |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
RD-PLA2G5-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 723 |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
SEM563Hu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 5189.65 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IVD (PLA2G4D) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
SEM563Hu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 515.03 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IVD (PLA2G4D) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
SEM563Hu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 692.9 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IVD (PLA2G4D) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
SEM563Hu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2818.05 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IVD (PLA2G4D) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
4-SEM563Hu |
Cloud-Clone |
-
EUR 5240.00
-
EUR 2769.00
-
EUR 693.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
- Known also as Phospholipase A2, Group IVD elisa. Alternative names of the recognized antigen: cPLA2delta
- Cytosolic phospholipase A2 delta
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species. |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
SEN729Hu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 5189.65 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group XIIB (PLA2G12B) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Ass
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
SEN729Hu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 515.03 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group XIIB (PLA2G12B) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Ass
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
SEN729Hu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 692.9 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group XIIB (PLA2G12B) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Ass
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
SEN729Hu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2818.05 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group XIIB (PLA2G12B) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Ass
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
4-SEN729Hu |
Cloud-Clone |
-
EUR 5240.00
-
EUR 2769.00
-
EUR 693.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
- Known also as Phospholipase A2, Group XIIB elisa. Alternative names of the recognized antigen: PLA2G13
- FKSG71
- GXIIB
- Phospholipase A2, Group XIII
- Group XIIB secretory phospholipase A2-like protein
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from Serum, plasma, tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species. |
Phospholipase A2, Group Ive Antibody |
20-abx114482 |
Abbexa |
|
|
- Shipped within 5-10 working days.
|
Phospholipase A2, Group Ivf Antibody |
20-abx114483 |
Abbexa |
|
|
- Shipped within 5-10 working days.
|
Phospholipase A2, Group Xiia Antibody |
20-abx114484 |
Abbexa |
|
|
- Shipped within 5-10 working days.
|
Phospholipase A2, Group Xiib Antibody |
20-abx114485 |
Abbexa |
|
|
- Shipped within 5-10 working days.
|
Secreted Phospholipase A2-X (Recombinant) |
20-abx073638 |
Abbexa |
-
EUR 328.00
-
EUR 5311.00
-
EUR 230.00
|
|
- Shipped within 5-10 working days.
|
Recombinant Human Secreted Phospholipase A2-X |
7-03355 |
CHI Scientific |
2µg |
Ask for price |
Recombinant Human Secreted Phospholipase A2-X |
7-03356 |
CHI Scientific |
10µg |
Ask for price |
Recombinant Human Secreted Phospholipase A2-X |
7-03357 |
CHI Scientific |
1mg |
Ask for price |
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
DLR-PLA2G2A-Mu-48T |
DL Develop |
48T |
EUR 527 |
- Should the Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
DLR-PLA2G2A-Mu-96T |
DL Develop |
96T |
EUR 688 |
- Should the Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
DLR-PLA2G2A-Ra-48T |
DL Develop |
48T |
EUR 549 |
- Should the Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
DLR-PLA2G2A-Ra-96T |
DL Develop |
96T |
EUR 718 |
- Should the Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
DLR-PLA2G2D-Mu-48T |
DL Develop |
48T |
EUR 508 |
- Should the Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
DLR-PLA2G2D-Mu-96T |
DL Develop |
96T |
EUR 661 |
- Should the Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit |
DLR-PLA2G3-Mu-48T |
DL Develop |
48T |
EUR 527 |
- Should the Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids. |
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit |
DLR-PLA2G3-Mu-96T |
DL Develop |
96T |
EUR 688 |
- Should the Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids. |
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
20-abx155982 |
Abbexa |
-
EUR 7237.00
-
EUR 3855.00
-
EUR 895.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-7 working days.
|
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
20-abx154554 |
Abbexa |
-
EUR 7378.00
-
EUR 3933.00
-
EUR 911.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-7 working days.
|
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
20-abx154555 |
Abbexa |
-
EUR 7237.00
-
EUR 3855.00
-
EUR 895.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-7 working days.
|
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit |
20-abx154556 |
Abbexa |
-
EUR 7378.00
-
EUR 3933.00
-
EUR 911.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-7 working days.
|
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
abx254356-96tests |
Abbexa |
96 tests |
EUR 707 |
- Shipped within 5-12 working days.
|
Rat Group IIA phospholipase A2 (PLA2G2A) ELISA Kit |
abx255942-96tests |
Abbexa |
96 tests |
EUR 707 |
- Shipped within 5-12 working days.
|
Bovine Group XV phospholipase A2, PLA2G15 ELISA KIT |
ELI-14523b |
Lifescience Market |
96 Tests |
EUR 928 |
Mouse Group XV phospholipase A2, Pla2g15 ELISA KIT |
ELI-14703m |
Lifescience Market |
96 Tests |
EUR 865 |
Cow Group IIA phospholipase A2 (PLA2G2A) ELISA Kit |
abx520902-96tests |
Abbexa |
96 tests |
EUR 911 |
- Shipped within 5-12 working days.
|
Rat Group IIA phospholipase A2 (PLA2G2A) ELISA Kit |
abx572864-96tests |
Abbexa |
96 tests |
EUR 707 |
- Shipped within 5-12 working days.
|
Mouse Group IIA phospholipase A2 (PLA2G2A) ELISA Kit |
abx575023-96tests |
Abbexa |
96 tests |
EUR 739 |
- Shipped within 5-12 working days.
|
Mouse Phospholipase A2 Group VI (PLA2G6) ELISA Kit |
abx512875-96tests |
Abbexa |
96 tests |
EUR 668 |
- Shipped within 5-12 working days.
|
Rat Phospholipase A2 Group VI (PLA2G6) ELISA Kit |
abx512877-96tests |
Abbexa |
96 tests |
EUR 668 |
- Shipped within 5-12 working days.
|
Mouse PLA2G2D(Phospholipase A2, Group IID) ELISA Kit |
EM1297 |
FN Test |
96T |
EUR 524.1 |
- Detection range: 31.25-2000 pg/ml
- Uniprot ID: Q9WVF6
- Alias: PLA2G2D
|
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 18.75pg/ml |
Rat PLA2G2A(Phospholipase A2,Group IIA) ELISA Kit |
ER1276 |
FN Test |
96T |
EUR 524.1 |
- Detection range: 0.156-10 ng/ml
- Uniprot ID: P14423
- Alias: PLA2G2A/Mom1/PLA2B/PLA2L/RASF-A/GIIC sPLA2/Group IIA phospholipase A2/MOM1/Non-pancreatic secretory phospholipase A2/NPS-PLA2/Phosphatidylcholine 2-acylhydrolase 2A/phospholipase A2, group IIA
- Show more
|
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Rattus;Sensitivity: 0.094 ng/ml |
Mouse Group XVI phospholipase A2, Pla2g16 ELISA KIT |
ELI-37775m |
Lifescience Market |
96 Tests |
EUR 865 |
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
SED827Mu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4862.4 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
SED827Mu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 488.08 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
SED827Mu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 654.4 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
SED827Mu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2644.8 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
4-SED827Mu |
Cloud-Clone |
-
EUR 4913.00
-
EUR 2595.00
-
EUR 655.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
- Known also as Phospholipase A2, Group IIA elisa. Alternative names of the recognized antigen: PLA2
- MOM1
- PLA2B
- PLA2L
- PLA2S
- PLAS1
- sPLA2(platelets, synovial fluid)
- Non-pancreatic secretory phospholipase A2
- Phosphatidylcholine 2-acylhydrolase 2A
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species. |
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
SED827Ra-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 5124.2 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay:
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
SED827Ra-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 509.64 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay:
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
SED827Ra-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 685.2 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay:
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
SED827Ra-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2783.4 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay:
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
4-SED827Ra |
Cloud-Clone |
-
EUR 5175.00
-
EUR 2734.00
-
EUR 686.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
- Known also as Phospholipase A2, Group IIA elisa. Alternative names of the recognized antigen: PLA2
- MOM1
- PLA2B
- PLA2L
- PLA2S
- PLAS1
- sPLA2(platelets, synovial fluid)
- Non-pancreatic secretory phospholipase A2
- Phosphatidylcholine 2-acylhydrolase 2A
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in samples from Serum, plasma, tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species. |
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit |
SED831Mu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4862.4 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group III (PLA2G3) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay:
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group III (PLA2G3) in serum, plasma and other biological fluids. |
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit |
SED831Mu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 488.08 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group III (PLA2G3) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay:
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group III (PLA2G3) in serum, plasma and other biological fluids. |
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit |
SED831Mu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 654.4 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group III (PLA2G3) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay:
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group III (PLA2G3) in serum, plasma and other biological fluids. |
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit |
SED831Mu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2644.8 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group III (PLA2G3) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay:
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group III (PLA2G3) in serum, plasma and other biological fluids. |
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit |
4-SED831Mu |
Cloud-Clone |
-
EUR 4913.00
-
EUR 2595.00
-
EUR 655.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
- Known also as Phospholipase A2, Group III elisa. Alternative names of the recognized antigen: GIII-SPLA2
- sPLA2-III
- Group 3 secretory phospholipase A2
- Group III secretory phospholipase A2
- Phosphatidylcholine 2-acylhydrolase 3
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Phospholipase A2, Group III (PLA2G3) in samples from Serum, plasma and other biological fluids. with no significant corss-reactivity with analogues from other species. |
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
SEB077Mu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4626.78 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group IID (PLA2G2D) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids. |
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
SEB077Mu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 468.68 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group IID (PLA2G2D) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids. |
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
SEB077Mu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 626.68 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group IID (PLA2G2D) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids. |
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
SEB077Mu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2520.06 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group IID (PLA2G2D) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids. |
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
4-SEB077Mu |
Cloud-Clone |
-
EUR 4677.00
-
EUR 2471.00
-
EUR 627.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
- Known also as Phospholipase A2, Group IID elisa. Alternative names of the recognized antigen: PLA2G2D
- sPLA2S
- s-PLA2
- sPLA2
- SPLASH
- Secreted Phospholipase A2
- Phosphatidylcholine 2-acylhydrolase 2D
- Secretory-type PLA, stroma-associated homolog
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in samples from Serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species. |
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
RDR-PLA2G2A-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 557 |
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
RDR-PLA2G2A-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 774 |
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
RDR-PLA2G2A-Ra-48Tests |
Reddot Biotech |
48 Tests |
EUR 583 |
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
RDR-PLA2G2A-Ra-96Tests |
Reddot Biotech |
96 Tests |
EUR 811 |
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
RDR-PLA2G2D-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 534 |
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
RDR-PLA2G2D-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 742 |
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit |
RDR-PLA2G3-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 557 |
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit |
RDR-PLA2G3-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 774 |
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
RD-PLA2G2A-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 533 |
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
RD-PLA2G2A-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 740 |
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
RD-PLA2G2A-Ra-48Tests |
Reddot Biotech |
48 Tests |
EUR 557 |
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
RD-PLA2G2A-Ra-96Tests |
Reddot Biotech |
96 Tests |
EUR 775 |
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
RD-PLA2G2D-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 511 |
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
RD-PLA2G2D-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 709 |
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit |
RD-PLA2G3-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 533 |
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit |
RD-PLA2G3-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 740 |
ELISA kit for Human PLA2G12B (Phospholipase A2, Group ? B) |
E-EL-H1029 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 534 |
- Gentaur's PLA2G12B ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human PLA2G12B. Standards or samples are added to the micro ELISA plate wells and combined
- Show more
|
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G12B (Phospholipase A2, Group ? B) in samples from Serum, Plasma, Cell supernatant |
ELISA kit for Human PLA2G4D (Phospholipase A2, Group ? D) |
E-EL-H1048 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 534 |
- Gentaur's PLA2G4D ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human PLA2G4D. Standards or samples are added to the micro ELISA plate wells and combined w
- Show more
|
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G4D (Phospholipase A2, Group ? D) in samples from Serum, Plasma, Cell supernatant |
ELISA kit for Human PLA2G2D (Phospholipase A2, Group ?D) |
E-EL-H2384 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 534 |
- Gentaur's PLA2G2D ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human PLA2G2D. Standards or samples are added to the micro ELISA plate wells and combined w
- Show more
|
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G2D (Phospholipase A2, Group ?D) in samples from Serum, Plasma, Cell supernatant |
ELISA kit for Human PLA2G2A (Phospholipase A2, Group ?A) |
E-EL-H2385 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 534 |
- Gentaur's PLA2G2A ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human PLA2G2A. Standards or samples are added to the micro ELISA plate wells and combined w
- Show more
|
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G2A (Phospholipase A2, Group ?A) in samples from Serum, Plasma, Cell supernatant |
Human Group XIIA secretory phospholipase A2(PLA2G12A) ELISA kit |
CSB-EL018086HU-24T |
Cusabio |
1 plate of 24 wells |
EUR 165 |
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativecompetitive ELISA kit for measuring Human Group XIIA secretory phospholipase A2 (PLA2G12A) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Human Group XIIA secretory phospholipase A2(PLA2G12A) ELISA kit |
1-CSB-EL018086HU |
Cusabio |
-
EUR 804.00
-
EUR 5099.00
-
EUR 2704.00
|
-
1 plate of 96 wells
-
10 plates of 96 wells each
-
5 plates of 96 wells each
|
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativecompetitive ELISA kit for measuring Human Group XIIA secretory phospholipase A2(PLA2G12A) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Human Group IIF secretory phospholipase A2(PLA2G2F) ELISA kit |
CSB-EL018095HU-24T |
Cusabio |
1 plate of 24 wells |
EUR 165 |
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Human Group IIF secretory phospholipase A2 (PLA2G2F) in samples from serum, plasma, tissue, homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Human Group IIF secretory phospholipase A2(PLA2G2F) ELISA kit |
1-CSB-EL018095HU |
Cusabio |
-
EUR 804.00
-
EUR 5099.00
-
EUR 2704.00
|
-
1 plate of 96 wells
-
10 plates of 96 wells each
-
5 plates of 96 wells each
|
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Human Group IIF secretory phospholipase A2(PLA2G2F) in samples from serum, plasma, tissue, homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Human Phospholipase A2, Group II A (PLA2G2A) ELISA Kit |
abx251779-96tests |
Abbexa |
96 tests |
EUR 754 |
- Shipped within 5-12 working days.
|
Human Phospholipase A2, Group XII B (PLA2G12B) ELISA Kit |
abx252991-96tests |
Abbexa |
96 tests |
EUR 707 |
- Shipped within 5-12 working days.
|
Human Phospholipase A2, Group IV D (PLA2G4D) ELISA Kit |
abx252993-96tests |
Abbexa |
96 tests |
EUR 707 |
- Shipped within 5-12 working days.
|
Human PLA2G12B(Phospholipase A2, Group XII B) ELISA Kit |
EH3604 |
FN Test |
96T |
EUR 524.1 |
- Detection range: 0.156-10 ng/ml
- Uniprot ID: Q9BX93
- Alias: PLA2G12B
|
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.094 ng/ml |
Human PLA2G4D(Phospholipase A2, Group IV D) ELISA Kit |
EH3606 |
FN Test |
96T |
EUR 524.1 |
- Detection range: 0.156-10 ng/ml
- Uniprot ID: Q86XP0
- Alias: PLA2G4D
|
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.094 ng/ml |
Human Group XIIA secretory phospholipase A2, PLA2G12A ELISA KIT |
ELI-21567h |
Lifescience Market |
96 Tests |
EUR 824 |
Human Group IIF secretory phospholipase A2, PLA2G2F ELISA KIT |
ELI-23295h |
Lifescience Market |
96 Tests |
EUR 824 |
ELISA kit for Human PLA2G2A (Phospholipase A2, Group IIA) |
ELK3752 |
ELK Biotech |
1 plate of 96 wells |
EUR 432 |
- The microtiter plate provided in this kit has been pre-coated with an antibody specific to Phospholipase A2, Group IIA (PLA2G2A). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific
- Show more
|
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group IIA from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
ELISA kit for Human PLA2G5 (Phospholipase A2, Group V) |
ELK4777 |
ELK Biotech |
1 plate of 96 wells |
EUR 432 |
- The microtiter plate provided in this kit has been pre-coated with an antibody specific to Phospholipase A2, Group V (PLA2G5). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific to
- Show more
|
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group V from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
ELISA kit for Human PLA2G2D (Phospholipase A2, Group IID) |
ELK1754 |
ELK Biotech |
1 plate of 96 wells |
EUR 432 |
- The microtiter plate provided in this kit has been pre-coated with an antibody specific to Phospholipase A2, Group IID (PLA2G2D). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific
- Show more
|
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group IID from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
Human Group IID secretory phospholipase A2, PLA2G2D ELISA KIT |
ELI-45186h |
Lifescience Market |
96 Tests |
EUR 824 |
Human Phospholipase A2, Group II D (PLA2G2D) ELISA Kit |
abx354458-96tests |
Abbexa |
96 tests |
EUR 707 |
- Shipped within 5-12 working days.
|
Human Phospholipase A2 Group XII A (PLA2G12A) ELISA Kit |
abx382266-96tests |
Abbexa |
96 tests |
EUR 911 |
- Shipped within 5-12 working days.
|
Human Phospholipase A2 Group IV B (PLA2G4B) ELISA Kit |
abx382267-96tests |
Abbexa |
96 tests |
EUR 911 |
- Shipped within 5-12 working days.
|
Human Phospholipase A2 Group IV E (PLA2G4E) ELISA Kit |
abx382268-96tests |
Abbexa |
96 tests |
EUR 911 |
- Shipped within 5-12 working days.
|
Human Phospholipase A2 Group IV F (PLA2G4E) ELISA Kit |
20-abx382269 |
Abbexa |
-
EUR 7378.00
-
EUR 3933.00
-
EUR 911.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-12 working days.
|
ELISA kit for Human PLA2G12B (Phospholipase A2, Group XIIB) |
ELK6117 |
ELK Biotech |
1 plate of 96 wells |
EUR 432 |
- The microtiter plate provided in this kit has been pre-coated with an antibody specific to Phospholipase A2, Group XIIB (PLA2G12B). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specif
- Show more
|
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group XIIB from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
ELISA kit for Human PLA2G4D (Phospholipase A2, Group IVD) |
ELK6188 |
ELK Biotech |
1 plate of 96 wells |
EUR 432 |
- The microtiter plate provided in this kit has been pre-coated with an antibody specific to Phospholipase A2, Group IVD (PLA2G4D). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific
- Show more
|
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group IVD from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
Human Group IIE secretory phospholipase A2, PLA2G2E ELISA KIT |
ELI-35519h |
Lifescience Market |
96 Tests |
EUR 824 |
Human Group 3 secretory phospholipase A2, PLA2G3 ELISA KIT |
ELI-37656h |
Lifescience Market |
96 Tests |
EUR 824 |
Human Phospholipase A2, Group IIA (PLA2G2A) CLIA Kit |
20-abx494403 |
Abbexa |
-
EUR 7973.00
-
EUR 4246.00
-
EUR 981.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
Human Phospholipase A2, Group V (PLA2G5) CLIA Kit |
20-abx494407 |
Abbexa |
-
EUR 7973.00
-
EUR 4246.00
-
EUR 981.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
Human Phospholipase A2, Group IID (PLA2G2D) CLIA Kit |
20-abx492390 |
Abbexa |
-
EUR 7973.00
-
EUR 4246.00
-
EUR 981.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
Human Phospholipase A2, Group IVD (PLA2G4D) CLIA Kit |
20-abx496066 |
Abbexa |
-
EUR 8569.00
-
EUR 4560.00
-
EUR 1052.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
Human Phospholipase A2, Group XIIB (PLA2G12B) CLIA Kit |
20-abx496107 |
Abbexa |
-
EUR 8569.00
-
EUR 4560.00
-
EUR 1052.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
Human Group IID secretory phospholipase A2 (PLA2G2D) |
1-CSB-EP891566HU |
Cusabio |
-
EUR 380.00
-
EUR 214.00
-
EUR 1309.00
-
EUR 560.00
-
EUR 873.00
-
EUR 262.00
|
-
100ug
-
10ug
-
1MG
-
200ug
-
500ug
-
50ug
|
- MW: 30.5 kDa
- Buffer composition: Tris-based buffer with 50% glycerol.
|
Description: Recombinant Human Group IID secretory phospholipase A2(PLA2G2D),partial expressed in E.coli |
Human Group XIIA secretory phospholipase A2 (PLA2G12A) |
1-CSB-YP863638HU |
Cusabio |
-
EUR 430.00
-
EUR 234.00
-
EUR 1508.00
-
EUR 642.00
-
EUR 1009.00
-
EUR 291.00
|
-
100ug
-
10ug
-
1MG
-
200ug
-
500ug
-
50ug
|
- MW: 20.3 kDa
- Buffer composition: Tris-based buffer with 50% glycerol.
|
Description: Recombinant Human Group XIIA secretory phospholipase A2(PLA2G12A),partial expressed in Yeast |
Human Phospholipase A2, Group IIA (PLA2G2A) Protein |
20-abx166841 |
Abbexa |
-
EUR 676.00
-
EUR 286.00
-
EUR 2082.00
-
EUR 801.00
-
EUR 481.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Human Phospholipase A2, Group IID (PLA2G2D) Protein |
20-abx654724 |
Abbexa |
-
EUR 578.00
-
EUR 258.00
-
EUR 1720.00
-
EUR 690.00
-
EUR 425.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-15 working days.
|
Human Phospholipase A2, Group V (PLA2G5) Protein |
20-abx654728 |
Abbexa |
-
EUR 578.00
-
EUR 258.00
-
EUR 1720.00
-
EUR 690.00
-
EUR 425.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-15 working days.
|
Human Phospholipase A2, Group XIIB (PLA2G12B) Protein |
20-abx654729 |
Abbexa |
-
EUR 578.00
-
EUR 258.00
-
EUR 1720.00
-
EUR 690.00
-
EUR 425.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-15 working days.
|
Human Phospholipase A2, Group III (PLA2G3) Protein |
20-abx650483 |
Abbexa |
-
EUR 704.00
-
EUR 286.00
-
EUR 2165.00
-
EUR 829.00
-
EUR 495.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Human Phospholipase A2, Group XII (PLA2G12) Protein |
20-abx650485 |
Abbexa |
-
EUR 704.00
-
EUR 286.00
-
EUR 2193.00
-
EUR 843.00
-
EUR 509.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Human Phospholipase A2, Group IVD (PLA2G4D) Protein |
20-abx650806 |
Abbexa |
-
EUR 648.00
-
EUR 272.00
-
EUR 1943.00
-
EUR 759.00
-
EUR 467.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Mouse Group XV phospholipase A2 (Pla2g15) |
1-CSB-EP840854MO |
Cusabio |
-
EUR 505.00
-
EUR 265.00
-
EUR 1827.00
-
EUR 766.00
-
EUR 1218.00
-
EUR 335.00
|
-
100ug
-
10ug
-
1MG
-
200ug
-
500ug
-
50ug
|
- MW: 50.5 kDa
- Buffer composition: Tris-based buffer with 50% glycerol.
|
Description: Recombinant Mouse Group XV phospholipase A2 (Pla2g15) expressed in E.coli |
Phospholipase A2 Group IVC (PLA2G4C) Antibody |
20-abx006526 |
Abbexa |
-
EUR 411.00
-
EUR 592.00
-
EUR 182.00
-
EUR 314.00
|
-
100 ul
-
200 ul
-
20 ul
-
50 ul
|
- Shipped within 5-10 working days.
|
Phospholipase A2, Group V (PLA2G5) Antibody |
abx028287-400ul |
Abbexa |
400 ul |
EUR 523 |
- Shipped within 5-10 working days.
|
Phospholipase A2, Group V (PLA2G5) Antibody |
abx028287-80l |
Abbexa |
80 µl |
EUR 286 |
- Shipped within 5-10 working days.
|
Phospholipase A2, Group IIA (PLA2G2A) Antibody |
20-abx177998 |
Abbexa |
|
|
|
Phospholipase A2, Group IIA (PLA2G2A) Antibody |
20-abx177999 |
Abbexa |
|
|
|
Phospholipase A2, Group IID (PLA2G2D) Antibody |
20-abx178000 |
Abbexa |
|
|
|
Phospholipase A2, Group IID (PLA2G2D) Antibody |
20-abx178001 |
Abbexa |
|
|
|
Phospholipase A2, Group III (PLA2G3) Antibody |
20-abx178002 |
Abbexa |
|
|
|
Phospholipase A2, Group III (PLA2G3) Antibody |
20-abx178003 |
Abbexa |
|
|
|
Phospholipase A2, Group V (PLA2G5) Antibody |
20-abx178004 |
Abbexa |
|
|
|
Phospholipase A2, Group XIIB (PLA2G12B) Antibody |
20-abx178005 |
Abbexa |
|
|
|
Phospholipase A2, Group IIA (PLA2G2A) Antibody |
20-abx103197 |
Abbexa |
-
EUR 453.00
-
EUR 133.00
-
EUR 1302.00
-
EUR 620.00
-
EUR 342.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Phospholipase A2, Group IID (PLA2G2D) Antibody |
20-abx103198 |
Abbexa |
-
EUR 300.00
-
EUR 133.00
-
EUR 801.00
-
EUR 425.00
-
EUR 258.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Phospholipase A2, Group Ivd (Cytosolic) Antibody |
20-abx114481 |
Abbexa |
|
|
- Shipped within 5-10 working days.
|
Phospholipase A2 Group VI (PLA2G6) Antibody |
20-abx124080 |
Abbexa |
-
EUR 411.00
-
EUR 592.00
-
EUR 182.00
-
EUR 314.00
|
-
100 ul
-
200 ul
-
20 ul
-
50 ul
|
- Shipped within 5-10 working days.
|
Phospholipase A2, Group IIA (PLA2G2A) Antibody |
20-abx128864 |
Abbexa |
-
EUR 425.00
-
EUR 133.00
-
EUR 1205.00
-
EUR 578.00
-
EUR 328.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Phospholipase A2, Group IID (PLA2G2D) Antibody |
20-abx130118 |
Abbexa |
-
EUR 439.00
-
EUR 133.00
-
EUR 1233.00
-
EUR 592.00
-
EUR 328.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Phospholipase A2, Group IVD (PLA2G4D) Antibody |
20-abx130913 |
Abbexa |
-
EUR 453.00
-
EUR 133.00
-
EUR 1316.00
-
EUR 620.00
-
EUR 342.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Phospholipase A2, Group III (PLA2G3) Antibody |
20-abx131085 |
Abbexa |
-
EUR 328.00
-
EUR 133.00
-
EUR 871.00
-
EUR 453.00
-
EUR 272.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Phospholipase A2, Group III (PLA2G3) Antibody |
20-abx131086 |
Abbexa |
-
EUR 425.00
-
EUR 133.00
-
EUR 1205.00
-
EUR 578.00
-
EUR 328.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Phospholipase A2, Group XII (PLA2G12) Antibody |
20-abx131471 |
Abbexa |
-
EUR 439.00
-
EUR 133.00
-
EUR 1233.00
-
EUR 592.00
-
EUR 328.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Phospholipase A2, Group XII (PLA2G12) Antibody |
20-abx131472 |
Abbexa |
-
EUR 425.00
-
EUR 133.00
-
EUR 1205.00
-
EUR 578.00
-
EUR 328.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|