Human PLA2G10(Phospholipase A2, Group X) ELISA Kit

Human PLA2G10(Phospholipase A2, Group X) ELISA Kit

To Order Contact us: michael@lotusbiotechnologies.com

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
RDR-PLA2G10-Hu-48Tests	Reddot Biotech	48 Tests	EUR 544

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
RDR-PLA2G10-Hu-96Tests	Reddot Biotech	96 Tests	EUR 756

Phospholipase A2, Group X (PLA2G10) Antibody
20-abx126373	Abbexa	EUR 411.00 EUR 592.00 EUR 182.00 EUR 314.00	100 ul 200 ul 20 ul 50 ul
Shipped within 5-10 working days.

Phospholipase A2, Group X (PLA2G10) Antibody
20-abx128169	Abbexa	EUR 425.00 EUR 133.00 EUR 1205.00 EUR 578.00 EUR 328.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Phospholipase A2, Group X (PLA2G10) Antibody
20-abx174048	Abbexa	EUR 857.00 EUR 439.00	1 mg 200 ug
Please enquire.

Phospholipase A2, Group X (PLA2G10) Antibody
20-abx301835	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug
Shipped within 5-10 working days.

Recombinant Phospholipase A2, Group X (PLA2G10)
4-RPD833Hu01	Cloud-Clone	EUR 501.41 EUR 237.00 EUR 1605.28 EUR 601.76 EUR 1103.52 EUR 398.00 EUR 3863.20	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: O15496 Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300. Form: Freeze-dried powder Predicted Molecular Mass (KD): 18.7KDa Isoelectric Point: Inquire
Description: Recombinant Human Phospholipase A2, Group X expressed in: E.coli

Human PLA2G10(Phospholipase A2, Group X) ELISA Kit
EH3603	FN Test	96T	EUR 524.1
Detection range: 7.813-500 pg/ml Uniprot ID: O15496 Alias: PLA2G10
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 4.688pg/ml

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
20-abx152758	Abbexa	EUR 7378.00 EUR 3933.00 EUR 911.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx252990-96tests	Abbexa	96 tests	EUR 668
Shipped within 5-12 working days.

Human Phospholipase A2, Group X (PLA2G10)ELISA kit
201-12-2526	SunredBio	96 tests	EUR 440
This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Phospholipase A2, Group X(PLA2G10)ELISA Kit
QY-E05176	Qayee Biotechnology	96T	EUR 361

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
SED833Hu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4731.5
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group X (PLA2G10) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
SED833Hu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 477.3
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group X (PLA2G10) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
SED833Hu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 639
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group X (PLA2G10) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
SED833Hu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2575.5
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group X (PLA2G10) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
4-SED833Hu	Cloud-Clone	EUR 4782.00 EUR 2526.00 EUR 640.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Phospholipase A2, Group X elisa. Alternative names of the recognized antigen: GXPLA2 GX sPLA2 sPLA2-X Group 10 secretory phospholipase A2 Phosphatidylcholine 2-acylhydrolase 10
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group X (PLA2G10) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species.

Human Phospholipase A2, Group X (PLA2G10) Protein
20-abx167064	Abbexa	EUR 704.00 EUR 286.00 EUR 2165.00 EUR 829.00 EUR 495.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Monkey Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx360270-96tests	Abbexa	96 tests	EUR 825
Shipped within 5-12 working days.

Pig Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx362012-96tests	Abbexa	96 tests	EUR 825
Shipped within 5-12 working days.

Rabbit Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx362347-96tests	Abbexa	96 tests	EUR 825
Shipped within 5-12 working days.

Chicken Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx356098-96tests	Abbexa	96 tests	EUR 825
Shipped within 5-12 working days.

Human Phospholipase A2, Group X (PLA2G10) CLIA Kit
20-abx494408	Abbexa	EUR 7973.00 EUR 4246.00 EUR 981.00	10 × 96 tests 5 × 96 tests 96 tests
Please enquire.

Human Phospholipase A2, Group X (PLA2G10) CLIA Kit
abx197460-96tests	Abbexa	96 tests	EUR 825
Shipped within 5-12 working days.

ELISA kit for Human PLA2G10 (Phospholipase A2, Group X)
ELK4236	ELK Biotech	1 plate of 96 wells	EUR 432
The microtiter plate provided in this kit has been pre-coated with an antibody specific to Phospholipase A2, Group X (PLA2G10). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific t Show more
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group X from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Human PLA2G10 (Phospholipase A2, Group X)
E-EL-H1011	Elabscience Biotech	1 plate of 96 wells	EUR 534
Gentaur's PLA2G10 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human PLA2G10. Standards or samples are added to the micro ELISA plate wells and combined w Show more
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G10 (Phospholipase A2, Group X) in samples from Serum, Plasma, Cell supernatant

Phospholipase A2, Group X (PLA2G10) Antibody (HRP)
20-abx315919	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug
Shipped within 5-10 working days.

Phospholipase A2, Group X (PLA2G10) Antibody (FITC)
20-abx315920	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug
Shipped within 5-10 working days.

Phospholipase A2, Group X (PLA2G10) Antibody (Biotin)
20-abx315921	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug
Shipped within 5-10 working days.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human)
4-PAD833Hu01	Cloud-Clone	EUR 247.00 EUR 2510.00 EUR 625.00 EUR 310.00 EUR 214.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: PLA2G10 (Glu32~Asp165) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10)

CLIA kit for Human PLA2G10 (Phospholipase A2, Group X)
E-CL-H0681	Elabscience Biotech	1 plate of 96 wells	EUR 584
Gentaur's PLA2G10 CLIA kit utilizes the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Human PLA2G10 . Standards or samples are added to the micro CLIA plate wells and combined wit Show more
Description: A sandwich CLIA kit for quantitative measurement of Human PLA2G10 (Phospholipase A2, Group X) in samples from Serum, Plasma, Cell supernatant

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), APC
4-PAD833Hu01-APC	Cloud-Clone	EUR 345.00 EUR 3275.00 EUR 912.00 EUR 440.00 EUR 219.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: PLA2G10 (Glu32~Asp165) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with APC.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), Biotinylated
4-PAD833Hu01-Biotin	Cloud-Clone	EUR 311.00 EUR 2460.00 EUR 727.00 EUR 381.00 EUR 219.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: PLA2G10 (Glu32~Asp165) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with Biotin.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), Cy3
4-PAD833Hu01-Cy3	Cloud-Clone	EUR 419.00 EUR 4325.00 EUR 1175.00 EUR 545.00 EUR 251.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: PLA2G10 (Glu32~Asp165) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with Cy3.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), FITC
4-PAD833Hu01-FITC	Cloud-Clone	EUR 296.00 EUR 2640.00 EUR 750.00 EUR 372.00 EUR 195.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: PLA2G10 (Glu32~Asp165) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with FITC.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), HRP
4-PAD833Hu01-HRP	Cloud-Clone	EUR 316.00 EUR 2855.00 EUR 807.00 EUR 398.00 EUR 206.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: PLA2G10 (Glu32~Asp165) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with HRP.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), PE
4-PAD833Hu01-PE	Cloud-Clone	EUR 296.00 EUR 2640.00 EUR 750.00 EUR 372.00 EUR 195.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: PLA2G10 (Glu32~Asp165) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with PE.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), APC-Cy7
4-PAD833Hu01-APC-Cy7	Cloud-Clone	EUR 571.00 EUR 6430.00 EUR 1705.00 EUR 760.00 EUR 319.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: PLA2G10 (Glu32~Asp165) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with APC-Cy7.

Human Group 10 secretory phospholipase A2, PLA2G10 ELISA KIT
ELI-37033h	Lifescience Market	96 Tests	EUR 824

Human Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
CSB-EL018085HU-24T	Cusabio	1 plate of 24 wells	EUR 165
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
1-CSB-EL018085HU	Cusabio	EUR 804.00 EUR 5099.00 EUR 2704.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse Group 10 secretory phospholipase A2, Pla2g10 ELISA KIT
ELI-16162m	Lifescience Market	96 Tests	EUR 865

Mouse Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
CSB-EL018085MO-24T	Cusabio	1 plate of 24 wells	EUR 165
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
1-CSB-EL018085MO	Cusabio	EUR 804.00 EUR 5099.00 EUR 2704.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Rat Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
CSB-EL018085RA-24T	Cusabio	1 plate of 24 wells	EUR 165
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Rat Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
1-CSB-EL018085RA	Cusabio	EUR 804.00 EUR 5099.00 EUR 2704.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Rat Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

PLA2G10 Secreted Phospholipase A2-X Human Recombinant Protein
PROTO15496	BosterBio	Regular: 10ug	EUR 317
Description: Secreted Phospholipase A2-X Human Recombinant is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag (underlined).;MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQ;PRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQE;LLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD.

ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10)
KTE100470-48T	Abbkine	48T	EUR 332
The A2 phospholipases (PLA2s EC 3.1.1.4) catalyze the release of fatty acids from phospholipids and play a role in a wide range of physiologic functions. Cupillard et al. (1997) cloned a novel secretory PLA2, termed GXSPLA2, from a human fetal lung Show more
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10)
KTE100470-5platesof96wells	Abbkine	5 plates of 96 wells	EUR 2115
The A2 phospholipases (PLA2s EC 3.1.1.4) catalyze the release of fatty acids from phospholipids and play a role in a wide range of physiologic functions. Cupillard et al. (1997) cloned a novel secretory PLA2, termed GXSPLA2, from a human fetal lung Show more
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10)
KTE100470-96T	Abbkine	96T	EUR 539
The A2 phospholipases (PLA2s EC 3.1.1.4) catalyze the release of fatty acids from phospholipids and play a role in a wide range of physiologic functions. Cupillard et al. (1997) cloned a novel secretory PLA2, termed GXSPLA2, from a human fetal lung Show more
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Human Group IIA phospholipase A2 (PLA2G2A) ELISA Kit
abx575929-96tests	Abbexa	96 tests	EUR 739
Shipped within 5-12 working days.

Human Group XV phospholipase A2, PLA2G15 ELISA KIT
ELI-21820h	Lifescience Market	96 Tests	EUR 824

Human Group XVI phospholipase A2, PLA2G16 ELISA KIT
ELI-45167h	Lifescience Market	96 Tests	EUR 824

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
20-abx152759	Abbexa	EUR 7378.00 EUR 3933.00 EUR 911.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
20-abx152760	Abbexa	EUR 7378.00 EUR 3933.00 EUR 911.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
20-abx152761	Abbexa	EUR 7112.00 EUR 3792.00 EUR 879.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
20-abx152762	Abbexa	EUR 7378.00 EUR 3933.00 EUR 911.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
20-abx152763	Abbexa	EUR 7378.00 EUR 3933.00 EUR 911.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Human Phospholipase A2 Group VI (PLA2G6) ELISA Kit
abx253845-96tests	Abbexa	96 tests	EUR 668
Shipped within 5-12 working days.

Human Phospholipase A2, Group IID (PLA2G2D)ELISA kit
201-12-2525	SunredBio	96 tests	EUR 440
This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A)ELISA kit
201-12-2527	SunredBio	96 tests	EUR 440
This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Phospholipase A2, Group IVD (PLA2G4D)ELISA kit
201-12-2529	SunredBio	96 tests	EUR 440
This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B)ELISA kit
201-12-2530	SunredBio	96 tests	EUR 440
This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
DLR-PLA2G12B-Hu-48T	DL Develop	48T	EUR 554
Should the Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
DLR-PLA2G12B-Hu-96T	DL Develop	96T	EUR 725
Should the Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
DLR-PLA2G2A-Hu-48T	DL Develop	48T	EUR 517
Should the Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
DLR-PLA2G2A-Hu-96T	DL Develop	96T	EUR 673
Should the Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
DLR-PLA2G2D-Hu-48T	DL Develop	48T	EUR 498
Should the Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
DLR-PLA2G2D-Hu-96T	DL Develop	96T	EUR 647
Should the Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group III (PLA2G3) ELISA Kit
DLR-PLA2G3-Hu-48T	DL Develop	48T	EUR 517
Should the Human Phospholipase A2, Group III (PLA2G3) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids.

Human Phospholipase A2, Group III (PLA2G3) ELISA Kit
DLR-PLA2G3-Hu-96T	DL Develop	96T	EUR 673
Should the Human Phospholipase A2, Group III (PLA2G3) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
DLR-PLA2G4D-Hu-48T	DL Develop	48T	EUR 554
Should the Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
DLR-PLA2G4D-Hu-96T	DL Develop	96T	EUR 725
Should the Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from tissue homogenates or other biological fluids.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
DLR-PLA2G5-Hu-48T	DL Develop	48T	EUR 517
Should the Human Phospholipase A2, Group V (PLA2G5) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
DLR-PLA2G5-Hu-96T	DL Develop	96T	EUR 673
Should the Human Phospholipase A2, Group V (PLA2G5) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
SEB077Hu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4502.43
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IID (PLA2G2D) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
SEB077Hu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 458.44
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IID (PLA2G2D) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
SEB077Hu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 612.05
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IID (PLA2G2D) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
SEB077Hu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2454.23
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IID (PLA2G2D) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
4-SEB077Hu	Cloud-Clone	EUR 4553.00 EUR 2405.00 EUR 613.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Phospholipase A2, Group IID elisa. Alternative names of the recognized antigen: PLA2G2D sPLA2S s-PLA2 sPLA2 SPLASH Secreted Phospholipase A2 Phosphatidylcholine 2-acylhydrolase 2D Secretory-type PLA, stroma-associated homolog
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.

Human Phospholipase A2, Group IIA ELISA Kit (PLA2G2A)
RK02095	Abclonal	96 Tests	EUR 521

Human Phospholipase A2, Group IID ELISA Kit (PLA2G2D)
RK02096	Abclonal	96 Tests	EUR 521

Human Phospholipase A2, Group V ELISA Kit (PLA2G5)
RK02097	Abclonal	96 Tests	EUR 521

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
RD-PLA2G12B-Hu-48Tests	Reddot Biotech	48 Tests	EUR 563

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
RD-PLA2G12B-Hu-96Tests	Reddot Biotech	96 Tests	EUR 783

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RD-PLA2G2A-Hu-48Tests	Reddot Biotech	48 Tests	EUR 521

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RD-PLA2G2A-Hu-96Tests	Reddot Biotech	96 Tests	EUR 723

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
RD-PLA2G2D-Hu-48Tests	Reddot Biotech	48 Tests	EUR 500

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
RD-PLA2G2D-Hu-96Tests	Reddot Biotech	96 Tests	EUR 692

Human Phospholipase A2, Group III (PLA2G3) ELISA Kit
RD-PLA2G3-Hu-48Tests	Reddot Biotech	48 Tests	EUR 521

Human Phospholipase A2, Group III (PLA2G3) ELISA Kit
RD-PLA2G3-Hu-96Tests	Reddot Biotech	96 Tests	EUR 723

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
RD-PLA2G4D-Hu-48Tests	Reddot Biotech	48 Tests	EUR 563

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
RD-PLA2G4D-Hu-96Tests	Reddot Biotech	96 Tests	EUR 783

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
RD-PLA2G5-Hu-48Tests	Reddot Biotech	48 Tests	EUR 521

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
RD-PLA2G5-Hu-96Tests	Reddot Biotech	96 Tests	EUR 723

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
RDR-PLA2G12B-Hu-48Tests	Reddot Biotech	48 Tests	EUR 589

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
RDR-PLA2G12B-Hu-96Tests	Reddot Biotech	96 Tests	EUR 820

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RDR-PLA2G2A-Hu-48Tests	Reddot Biotech	48 Tests	EUR 544

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RDR-PLA2G2A-Hu-96Tests	Reddot Biotech	96 Tests	EUR 756

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
RDR-PLA2G2D-Hu-48Tests	Reddot Biotech	48 Tests	EUR 522

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
RDR-PLA2G2D-Hu-96Tests	Reddot Biotech	96 Tests	EUR 724

Human Phospholipase A2, Group III (PLA2G3) ELISA Kit
RDR-PLA2G3-Hu-48Tests	Reddot Biotech	48 Tests	EUR 544

Human Phospholipase A2, Group III (PLA2G3) ELISA Kit
RDR-PLA2G3-Hu-96Tests	Reddot Biotech	96 Tests	EUR 756

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
RDR-PLA2G4D-Hu-48Tests	Reddot Biotech	48 Tests	EUR 589

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
RDR-PLA2G4D-Hu-96Tests	Reddot Biotech	96 Tests	EUR 820

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
RDR-PLA2G5-Hu-48Tests	Reddot Biotech	48 Tests	EUR 544

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
RDR-PLA2G5-Hu-96Tests	Reddot Biotech	96 Tests	EUR 756

Human Phospholipase A2, Group XIIB(PLA2G12B)ELISA Kit
QY-E05175	Qayee Biotechnology	96T	EUR 361

Human Phospholipase A2, Group IVD(PLA2G4D)ELISA Kit
QY-E05205	Qayee Biotechnology	96T	EUR 361

Human Phospholipase A2, Group IID(PLA2G2D)ELISA Kit
QY-E05226	Qayee Biotechnology	96T	EUR 361

Human Phospholipase A2, Group IIA(PLA2G2A)ELISA Kit
QY-E05227	Qayee Biotechnology	96T	EUR 361

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Hu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4731.5
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Hu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 477.3
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Hu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 639
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Hu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2575.5
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
4-SED827Hu	Cloud-Clone	EUR 4782.00 EUR 2526.00 EUR 640.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Phospholipase A2, Group IIA elisa. Alternative names of the recognized antigen: PLA2 MOM1 PLA2B PLA2L PLA2S PLAS1 sPLA2(platelets, synovial fluid) Non-pancreatic secretory phospholipase A2 Phosphatidylcholine 2-acylhydrolase 2A
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
SED832Hu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4731.5
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group V (PLA2G5) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: C Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
SED832Hu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 477.3
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group V (PLA2G5) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: C Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
SED832Hu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 639
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group V (PLA2G5) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: C Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
SED832Hu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2575.5
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group V (PLA2G5) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: C Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
4-SED832Hu	Cloud-Clone	EUR 4782.00 EUR 2526.00 EUR 640.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Phospholipase A2, Group V elisa. Alternative names of the recognized antigen: PLA2-10 Calcium-dependent phospholipase A2 Group V phospholipase A2 Phosphatidylcholine 2-acylhydrolase 5
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
SEM563Hu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 5189.65
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IVD (PLA2G4D) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
SEM563Hu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 515.03
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IVD (PLA2G4D) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
SEM563Hu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 692.9
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IVD (PLA2G4D) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
SEM563Hu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2818.05
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group IVD (PLA2G4D) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
4-SEM563Hu	Cloud-Clone	EUR 5240.00 EUR 2769.00 EUR 693.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Phospholipase A2, Group IVD elisa. Alternative names of the recognized antigen: cPLA2delta Cytosolic phospholipase A2 delta
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
SEN729Hu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 5189.65
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group XIIB (PLA2G12B) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Ass Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
SEN729Hu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 515.03
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group XIIB (PLA2G12B) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Ass Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
SEN729Hu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 692.9
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group XIIB (PLA2G12B) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Ass Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
SEN729Hu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2818.05
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group XIIB (PLA2G12B) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Ass Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
4-SEN729Hu	Cloud-Clone	EUR 5240.00 EUR 2769.00 EUR 693.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Phospholipase A2, Group XIIB elisa. Alternative names of the recognized antigen: PLA2G13 FKSG71 GXIIB Phospholipase A2, Group XIII Group XIIB secretory phospholipase A2-like protein
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from Serum, plasma, tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.

Phospholipase A2, Group Ive Antibody
20-abx114482	Abbexa	EUR 732.00 EUR 398.00	150 ul 50 ul
Shipped within 5-10 working days.

Phospholipase A2, Group Ivf Antibody
20-abx114483	Abbexa	EUR 732.00 EUR 398.00	150 ul 50 ul
Shipped within 5-10 working days.

Phospholipase A2, Group Xiia Antibody
20-abx114484	Abbexa	EUR 732.00 EUR 398.00	150 ul 50 ul
Shipped within 5-10 working days.

Phospholipase A2, Group Xiib Antibody
20-abx114485	Abbexa	EUR 732.00 EUR 398.00	150 ul 50 ul
Shipped within 5-10 working days.

Secreted Phospholipase A2-X (Recombinant)
20-abx073638	Abbexa	EUR 328.00 EUR 5311.00 EUR 230.00	10 ug 1 mg 2 µg
Shipped within 5-10 working days.

Recombinant Human Secreted Phospholipase A2-X
7-03355	CHI Scientific	2µg	Ask for price

Recombinant Human Secreted Phospholipase A2-X
7-03356	CHI Scientific	10µg	Ask for price

Recombinant Human Secreted Phospholipase A2-X
7-03357	CHI Scientific	1mg	Ask for price

Cow Group IIA phospholipase A2 (PLA2G2A) ELISA Kit
abx520902-96tests	Abbexa	96 tests	EUR 911
Shipped within 5-12 working days.

Mouse Phospholipase A2 Group VI (PLA2G6) ELISA Kit
abx512875-96tests	Abbexa	96 tests	EUR 668
Shipped within 5-12 working days.

Rat Phospholipase A2 Group VI (PLA2G6) ELISA Kit
abx512877-96tests	Abbexa	96 tests	EUR 668
Shipped within 5-12 working days.

Rat Group IIA phospholipase A2 (PLA2G2A) ELISA Kit
abx572864-96tests	Abbexa	96 tests	EUR 707
Shipped within 5-12 working days.

Mouse Group IIA phospholipase A2 (PLA2G2A) ELISA Kit
abx575023-96tests	Abbexa	96 tests	EUR 739
Shipped within 5-12 working days.

Bovine Group XV phospholipase A2, PLA2G15 ELISA KIT
ELI-14523b	Lifescience Market	96 Tests	EUR 928

Mouse Group XV phospholipase A2, Pla2g15 ELISA KIT
ELI-14703m	Lifescience Market	96 Tests	EUR 865

Rat PLA2G2A(Phospholipase A2,Group IIA) ELISA Kit
ER1276	FN Test	96T	EUR 524.1
Detection range: 0.156-10 ng/ml Uniprot ID: P14423 Alias: PLA2G2A/Mom1/PLA2B/PLA2L/RASF-A/GIIC sPLA2/Group IIA phospholipase A2/MOM1/Non-pancreatic secretory phospholipase A2/NPS-PLA2/Phosphatidylcholine 2-acylhydrolase 2A/phospholipase A2, group IIA Show more
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Rattus;Sensitivity: 0.094 ng/ml

Mouse Group XVI phospholipase A2, Pla2g16 ELISA KIT
ELI-37775m	Lifescience Market	96 Tests	EUR 865

Mouse PLA2G2D(Phospholipase A2, Group IID) ELISA Kit
EM1297	FN Test	96T	EUR 524.1
Detection range: 31.25-2000 pg/ml Uniprot ID: Q9WVF6 Alias: PLA2G2D
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 18.75pg/ml

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
20-abx155982	Abbexa	EUR 7237.00 EUR 3855.00 EUR 895.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
20-abx154554	Abbexa	EUR 7378.00 EUR 3933.00 EUR 911.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
20-abx154555	Abbexa	EUR 7237.00 EUR 3855.00 EUR 895.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
20-abx154556	Abbexa	EUR 7378.00 EUR 3933.00 EUR 911.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Rat Group IIA phospholipase A2 (PLA2G2A) ELISA Kit
abx255942-96tests	Abbexa	96 tests	EUR 707
Shipped within 5-12 working days.

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
abx254356-96tests	Abbexa	96 tests	EUR 707
Shipped within 5-12 working days.

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
DLR-PLA2G2A-Mu-48T	DL Develop	48T	EUR 527
Should the Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
DLR-PLA2G2A-Mu-96T	DL Develop	96T	EUR 688
Should the Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
DLR-PLA2G2A-Ra-48T	DL Develop	48T	EUR 549
Should the Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
DLR-PLA2G2A-Ra-96T	DL Develop	96T	EUR 718
Should the Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
DLR-PLA2G2D-Mu-48T	DL Develop	48T	EUR 508
Should the Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids.

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
DLR-PLA2G2D-Mu-96T	DL Develop	96T	EUR 661
Should the Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids.

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
DLR-PLA2G3-Mu-48T	DL Develop	48T	EUR 527
Should the Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids.

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
DLR-PLA2G3-Mu-96T	DL Develop	96T	EUR 688
Should the Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids.

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
SEB077Mu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4626.78
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group IID (PLA2G2D) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
SEB077Mu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 468.68
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group IID (PLA2G2D) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
SEB077Mu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 626.68
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group IID (PLA2G2D) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
SEB077Mu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2520.06
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group IID (PLA2G2D) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids.

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
4-SEB077Mu	Cloud-Clone	EUR 4677.00 EUR 2471.00 EUR 627.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Phospholipase A2, Group IID elisa. Alternative names of the recognized antigen: PLA2G2D sPLA2S s-PLA2 sPLA2 SPLASH Secreted Phospholipase A2 Phosphatidylcholine 2-acylhydrolase 2D Secretory-type PLA, stroma-associated homolog
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in samples from Serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RD-PLA2G2A-Mu-48Tests	Reddot Biotech	48 Tests	EUR 533

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RD-PLA2G2A-Mu-96Tests	Reddot Biotech	96 Tests	EUR 740

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RD-PLA2G2A-Ra-48Tests	Reddot Biotech	48 Tests	EUR 557

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RD-PLA2G2A-Ra-96Tests	Reddot Biotech	96 Tests	EUR 775

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
RD-PLA2G2D-Mu-48Tests	Reddot Biotech	48 Tests	EUR 511

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
RD-PLA2G2D-Mu-96Tests	Reddot Biotech	96 Tests	EUR 709

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
RD-PLA2G3-Mu-48Tests	Reddot Biotech	48 Tests	EUR 533

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
RD-PLA2G3-Mu-96Tests	Reddot Biotech	96 Tests	EUR 740

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RDR-PLA2G2A-Mu-48Tests	Reddot Biotech	48 Tests	EUR 557

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RDR-PLA2G2A-Mu-96Tests	Reddot Biotech	96 Tests	EUR 774

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RDR-PLA2G2A-Ra-48Tests	Reddot Biotech	48 Tests	EUR 583

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
RDR-PLA2G2A-Ra-96Tests	Reddot Biotech	96 Tests	EUR 811

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
RDR-PLA2G2D-Mu-48Tests	Reddot Biotech	48 Tests	EUR 534

Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
RDR-PLA2G2D-Mu-96Tests	Reddot Biotech	96 Tests	EUR 742

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
RDR-PLA2G3-Mu-48Tests	Reddot Biotech	48 Tests	EUR 557

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
RDR-PLA2G3-Mu-96Tests	Reddot Biotech	96 Tests	EUR 774

Rat Phospholipase A2, Group IIA(PLA2G2A)ELISA Kit
QY-E10194	Qayee Biotechnology	96T	EUR 361

Rat Phospholipase A2(Group IVD(PLA2G4D)ELISA kit
QY-E10542	Qayee Biotechnology	96T	EUR 413

Rat Phospholipase A2(Group IID(PLA2G2D)ELISA kit
QY-E10543	Qayee Biotechnology	96T	EUR 413

Mouse Phospholipase A2(Group IID(PLA2G2D)ELISA kit
QY-E21172	Qayee Biotechnology	96T	EUR 361

Mouse Phospholipase A2(Group IVD(PLA2G4D)ELISA kit
QY-E21173	Qayee Biotechnology	96T	EUR 361

Mouse Phospholipase A2, Group IIA(PLA2G2A)ELISA Kit
QY-E21175	Qayee Biotechnology	96T	EUR 361

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Mu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4862.4
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Mu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 488.08
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Mu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 654.4
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Mu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2644.8
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
4-SED827Mu	Cloud-Clone	EUR 4913.00 EUR 2595.00 EUR 655.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Phospholipase A2, Group IIA elisa. Alternative names of the recognized antigen: PLA2 MOM1 PLA2B PLA2L PLA2S PLAS1 sPLA2(platelets, synovial fluid) Non-pancreatic secretory phospholipase A2 Phosphatidylcholine 2-acylhydrolase 2A
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Ra-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 5124.2
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Ra-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 509.64
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Ra-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 685.2
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
SED827Ra-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2783.4
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Phospholipase A2, Group IIA (PLA2G2A) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids.

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
4-SED827Ra	Cloud-Clone	EUR 5175.00 EUR 2734.00 EUR 686.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Phospholipase A2, Group IIA elisa. Alternative names of the recognized antigen: PLA2 MOM1 PLA2B PLA2L PLA2S PLAS1 sPLA2(platelets, synovial fluid) Non-pancreatic secretory phospholipase A2 Phosphatidylcholine 2-acylhydrolase 2A
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in samples from Serum, plasma, tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
SED831Mu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4862.4
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group III (PLA2G3) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group III (PLA2G3) in serum, plasma and other biological fluids.

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
SED831Mu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 488.08
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group III (PLA2G3) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group III (PLA2G3) in serum, plasma and other biological fluids.

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
SED831Mu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 654.4
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group III (PLA2G3) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group III (PLA2G3) in serum, plasma and other biological fluids.

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
SED831Mu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2644.8
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Phospholipase A2, Group III (PLA2G3) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group III (PLA2G3) in serum, plasma and other biological fluids.

Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit
4-SED831Mu	Cloud-Clone	EUR 4913.00 EUR 2595.00 EUR 655.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Phospholipase A2, Group III elisa. Alternative names of the recognized antigen: GIII-SPLA2 sPLA2-III Group 3 secretory phospholipase A2 Group III secretory phospholipase A2 Phosphatidylcholine 2-acylhydrolase 3
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Phospholipase A2, Group III (PLA2G3) in samples from Serum, plasma and other biological fluids. with no significant corss-reactivity with analogues from other species.

ELISA kit for Human PLA2G2D (Phospholipase A2, Group ?D)
E-EL-H2384	Elabscience Biotech	1 plate of 96 wells	EUR 534
Gentaur's PLA2G2D ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human PLA2G2D. Standards or samples are added to the micro ELISA plate wells and combined w Show more
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G2D (Phospholipase A2, Group ?D) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Human PLA2G2A (Phospholipase A2, Group ?A)
E-EL-H2385	Elabscience Biotech	1 plate of 96 wells	EUR 534
Gentaur's PLA2G2A ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human PLA2G2A. Standards or samples are added to the micro ELISA plate wells and combined w Show more
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G2A (Phospholipase A2, Group ?A) in samples from Serum, Plasma, Cell supernatant

Human PLA2G12B(Phospholipase A2, Group XII B) ELISA Kit
EH3604	FN Test	96T	EUR 524.1
Detection range: 0.156-10 ng/ml Uniprot ID: Q9BX93 Alias: PLA2G12B
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.094 ng/ml

Human PLA2G4D(Phospholipase A2, Group IV D) ELISA Kit
EH3606	FN Test	96T	EUR 524.1
Detection range: 0.156-10 ng/ml Uniprot ID: Q86XP0 Alias: PLA2G4D
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.094 ng/ml

Human Group XIIA secretory phospholipase A2, PLA2G12A ELISA KIT
ELI-21567h	Lifescience Market	96 Tests	EUR 824

Human Group IIF secretory phospholipase A2, PLA2G2F ELISA KIT
ELI-23295h	Lifescience Market	96 Tests	EUR 824

ELISA kit for Human PLA2G2A (Phospholipase A2, Group IIA)
ELK3752	ELK Biotech	1 plate of 96 wells	EUR 432
The microtiter plate provided in this kit has been pre-coated with an antibody specific to Phospholipase A2, Group IIA (PLA2G2A). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific Show more
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group IIA from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Human PLA2G5 (Phospholipase A2, Group V)
ELK4777	ELK Biotech	1 plate of 96 wells	EUR 432
The microtiter plate provided in this kit has been pre-coated with an antibody specific to Phospholipase A2, Group V (PLA2G5). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific to Show more
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group V from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Human PLA2G12B (Phospholipase A2, Group XIIB)
ELK6117	ELK Biotech	1 plate of 96 wells	EUR 432
The microtiter plate provided in this kit has been pre-coated with an antibody specific to Phospholipase A2, Group XIIB (PLA2G12B). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specif Show more
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group XIIB from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Human PLA2G4D (Phospholipase A2, Group IVD)
ELK6188	ELK Biotech	1 plate of 96 wells	EUR 432
The microtiter plate provided in this kit has been pre-coated with an antibody specific to Phospholipase A2, Group IVD (PLA2G4D). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific Show more
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group IVD from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Human PLA2G2D (Phospholipase A2, Group IID)
ELK1754	ELK Biotech	1 plate of 96 wells	EUR 432
The microtiter plate provided in this kit has been pre-coated with an antibody specific to Phospholipase A2, Group IID (PLA2G2D). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific Show more
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group IID from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Human Group IIE secretory phospholipase A2, PLA2G2E ELISA KIT
ELI-35519h	Lifescience Market	96 Tests	EUR 824

Human Group 3 secretory phospholipase A2, PLA2G3 ELISA KIT
ELI-37656h	Lifescience Market	96 Tests	EUR 824

Human Group IID secretory phospholipase A2, PLA2G2D ELISA KIT
ELI-45186h	Lifescience Market	96 Tests	EUR 824

Human Phospholipase A2, Group II D (PLA2G2D) ELISA Kit
abx354458-96tests	Abbexa	96 tests	EUR 707
Shipped within 5-12 working days.

Human Phospholipase A2 Group XII A (PLA2G12A) ELISA Kit
abx382266-96tests	Abbexa	96 tests	EUR 911
Shipped within 5-12 working days.

Human Phospholipase A2 Group IV B (PLA2G4B) ELISA Kit
abx382267-96tests	Abbexa	96 tests	EUR 911
Shipped within 5-12 working days.

Human Phospholipase A2 Group IV E (PLA2G4E) ELISA Kit
abx382268-96tests	Abbexa	96 tests	EUR 911
Shipped within 5-12 working days.

Human Phospholipase A2 Group IV F (PLA2G4E) ELISA Kit
20-abx382269	Abbexa	EUR 7378.00 EUR 3933.00 EUR 911.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-12 working days.

Human Phospholipase A2, Group II A (PLA2G2A) ELISA Kit
abx251779-96tests	Abbexa	96 tests	EUR 754
Shipped within 5-12 working days.

Human Phospholipase A2, Group XII B (PLA2G12B) ELISA Kit
abx252991-96tests	Abbexa	96 tests	EUR 707
Shipped within 5-12 working days.

Human Phospholipase A2, Group IV D (PLA2G4D) ELISA Kit
abx252993-96tests	Abbexa	96 tests	EUR 707
Shipped within 5-12 working days.

Human Group XIIA secretory phospholipase A2(PLA2G12A) ELISA kit
CSB-EL018086HU-24T	Cusabio	1 plate of 24 wells	EUR 165
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativecompetitive ELISA kit for measuring Human Group XIIA secretory phospholipase A2 (PLA2G12A) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Group XIIA secretory phospholipase A2(PLA2G12A) ELISA kit
1-CSB-EL018086HU	Cusabio	EUR 804.00 EUR 5099.00 EUR 2704.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativecompetitive ELISA kit for measuring Human Group XIIA secretory phospholipase A2(PLA2G12A) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Human Group IIF secretory phospholipase A2(PLA2G2F) ELISA kit
CSB-EL018095HU-24T	Cusabio	1 plate of 24 wells	EUR 165
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Group IIF secretory phospholipase A2 (PLA2G2F) in samples from serum, plasma, tissue, homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Group IIF secretory phospholipase A2(PLA2G2F) ELISA kit
1-CSB-EL018095HU	Cusabio	EUR 804.00 EUR 5099.00 EUR 2704.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Group IIF secretory phospholipase A2(PLA2G2F) in samples from serum, plasma, tissue, homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

ELISA kit for Human PLA2G12B (Phospholipase A2, Group ? B)
E-EL-H1029	Elabscience Biotech	1 plate of 96 wells	EUR 534
Gentaur's PLA2G12B ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human PLA2G12B. Standards or samples are added to the micro ELISA plate wells and combined Show more
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G12B (Phospholipase A2, Group ? B) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Human PLA2G4D (Phospholipase A2, Group ? D)
E-EL-H1048	Elabscience Biotech	1 plate of 96 wells	EUR 534
Gentaur's PLA2G4D ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human PLA2G4D. Standards or samples are added to the micro ELISA plate wells and combined w Show more
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G4D (Phospholipase A2, Group ? D) in samples from Serum, Plasma, Cell supernatant

Human Phospholipase A2, Group IVD (PLA2G4D) CLIA Kit
20-abx496066	Abbexa	EUR 8569.00 EUR 4560.00 EUR 1052.00	10 × 96 tests 5 × 96 tests 96 tests
Please enquire.

Human Phospholipase A2, Group XIIB (PLA2G12B) CLIA Kit
20-abx496107	Abbexa	EUR 8569.00 EUR 4560.00 EUR 1052.00	10 × 96 tests 5 × 96 tests 96 tests
Please enquire.

Human Phospholipase A2, Group IIA (PLA2G2A) CLIA Kit
20-abx494403	Abbexa	EUR 7973.00 EUR 4246.00 EUR 981.00	10 × 96 tests 5 × 96 tests 96 tests
Please enquire.

Human Phospholipase A2, Group V (PLA2G5) CLIA Kit
20-abx494407	Abbexa	EUR 7973.00 EUR 4246.00 EUR 981.00	10 × 96 tests 5 × 96 tests 96 tests
Please enquire.

Human Phospholipase A2, Group IID (PLA2G2D) CLIA Kit
20-abx492390	Abbexa	EUR 7973.00 EUR 4246.00 EUR 981.00	10 × 96 tests 5 × 96 tests 96 tests
Please enquire.

Human Phospholipase A2, Group IID (PLA2G2D) Protein
20-abx654724	Abbexa	EUR 578.00 EUR 258.00 EUR 1720.00 EUR 690.00 EUR 425.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-15 working days.

Human Phospholipase A2, Group V (PLA2G5) Protein
20-abx654728	Abbexa	EUR 578.00 EUR 258.00 EUR 1720.00 EUR 690.00 EUR 425.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-15 working days.

Human Phospholipase A2, Group XIIB (PLA2G12B) Protein
20-abx654729	Abbexa	EUR 578.00 EUR 258.00 EUR 1720.00 EUR 690.00 EUR 425.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-15 working days.

Human Phospholipase A2, Group III (PLA2G3) Protein
20-abx650483	Abbexa	EUR 704.00 EUR 286.00 EUR 2165.00 EUR 829.00 EUR 495.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Human Phospholipase A2, Group XII (PLA2G12) Protein
20-abx650485	Abbexa	EUR 704.00 EUR 286.00 EUR 2193.00 EUR 843.00 EUR 509.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Human Phospholipase A2, Group IVD (PLA2G4D) Protein
20-abx650806	Abbexa	EUR 648.00 EUR 272.00 EUR 1943.00 EUR 759.00 EUR 467.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Human Phospholipase A2, Group IIA (PLA2G2A) Protein
20-abx166841	Abbexa	EUR 676.00 EUR 286.00 EUR 2082.00 EUR 801.00 EUR 481.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Human Group XIIA secretory phospholipase A2 (PLA2G12A)
1-CSB-YP863638HU	Cusabio	EUR 430.00 EUR 234.00 EUR 1508.00 EUR 642.00 EUR 1009.00 EUR 291.00	100ug 10ug 1MG 200ug 500ug 50ug
MW: 20.3 kDa Buffer composition: Tris-based buffer with 50% glycerol.
Description: Recombinant Human Group XIIA secretory phospholipase A2(PLA2G12A),partial expressed in Yeast

Human Group IID secretory phospholipase A2 (PLA2G2D)
1-CSB-EP891566HU	Cusabio	EUR 380.00 EUR 214.00 EUR 1309.00 EUR 560.00 EUR 873.00 EUR 262.00	100ug 10ug 1MG 200ug 500ug 50ug
MW: 30.5 kDa Buffer composition: Tris-based buffer with 50% glycerol.
Description: Recombinant Human Group IID secretory phospholipase A2(PLA2G2D),partial expressed in E.coli

Phospholipase A2 Group VI (PLA2G6) Antibody
20-abx124080	Abbexa	EUR 411.00 EUR 592.00 EUR 182.00 EUR 314.00	100 ul 200 ul 20 ul 50 ul
Shipped within 5-10 working days.

Phospholipase A2, Group Ivd (Cytosolic) Antibody
20-abx114481	Abbexa	EUR 732.00 EUR 398.00	150 ul 50 ul
Shipped within 5-10 working days.

Phospholipase A2, Group IIA (PLA2G2A) Antibody
20-abx128864	Abbexa	EUR 425.00 EUR 133.00 EUR 1205.00 EUR 578.00 EUR 328.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Phospholipase A2, Group IID (PLA2G2D) Antibody
20-abx130118	Abbexa	EUR 439.00 EUR 133.00 EUR 1233.00 EUR 592.00 EUR 328.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Phospholipase A2, Group IVD (PLA2G4D) Antibody
20-abx130913	Abbexa	EUR 453.00 EUR 133.00 EUR 1316.00 EUR 620.00 EUR 342.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Phospholipase A2, Group III (PLA2G3) Antibody
20-abx131085	Abbexa	EUR 328.00 EUR 133.00 EUR 871.00 EUR 453.00 EUR 272.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Phospholipase A2, Group III (PLA2G3) Antibody
20-abx131086	Abbexa	EUR 425.00 EUR 133.00 EUR 1205.00 EUR 578.00 EUR 328.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Phospholipase A2, Group XII (PLA2G12) Antibody
20-abx131471	Abbexa	EUR 439.00 EUR 133.00 EUR 1233.00 EUR 592.00 EUR 328.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Phospholipase A2, Group XII (PLA2G12) Antibody
20-abx131472	Abbexa	EUR 425.00 EUR 133.00 EUR 1205.00 EUR 578.00 EUR 328.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Phospholipase A2 Group IVC (PLA2G4C) Antibody
20-abx134069	Abbexa	EUR 300.00 EUR 439.00 EUR 189.00	100 ul 200 ul 30 ul
Shipped within 5-10 working days.

Phospholipase A2, Group IIA (PLA2G2A) Antibody
20-abx103197	Abbexa	EUR 453.00 EUR 133.00 EUR 1302.00 EUR 620.00 EUR 342.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Phospholipase A2, Group IID (PLA2G2D) Antibody
20-abx103198	Abbexa	EUR 300.00 EUR 133.00 EUR 801.00 EUR 425.00 EUR 258.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Phospholipase A2 Group IVC (PLA2G4C) Antibody
20-abx006526	Abbexa	EUR 411.00 EUR 592.00 EUR 182.00 EUR 314.00	100 ul 200 ul 20 ul 50 ul
Shipped within 5-10 working days.

Phospholipase A2, Group III (PLA2G3) Antibody
abx030609-400ul	Abbexa	400 ul	EUR 523
Shipped within 5-10 working days.

Phospholipase A2, Group III (PLA2G3) Antibody
abx030609-80l	Abbexa	80 µl	EUR 286
Shipped within 5-10 working days.

Phospholipase A2, Group V (PLA2G5) Antibody
abx028287-400ul	Abbexa	400 ul	EUR 523
Shipped within 5-10 working days.

Phospholipase A2, Group V (PLA2G5) Antibody
abx028287-80l	Abbexa	80 µl	EUR 286
Shipped within 5-10 working days.

Phospholipase A2 Group IVC (PLA2G4C) Antibody
20-abx014417	Abbexa	EUR 314.00 EUR 98.00 EUR 398.00 EUR 495.00	100 ug 10 ug 200 ug 300 µg
Shipped within 5-10 working days.

Phospholipase A2, Group IIA (PLA2G2A) Antibody
20-abx174043	Abbexa	EUR 857.00 EUR 439.00	1 mg 200 ug
Please enquire.

Phospholipase A2, Group IIA (PLA2G2A) Antibody
20-abx174044	Abbexa	EUR 913.00 EUR 467.00	1 mg 200 ug
Please enquire.

Phospholipase A2, Group IID (PLA2G2D) Antibody
20-abx174045	Abbexa	EUR 815.00 EUR 425.00	1 mg 200 ug
Please enquire.

Phospholipase A2, Group IVD (PLA2G4D) Antibody
20-abx174046	Abbexa	EUR 926.00 EUR 467.00	1 mg 200 ug
Please enquire.

Phospholipase A2, Group V (PLA2G5) Antibody
20-abx174047	Abbexa	EUR 857.00 EUR 439.00	1 mg 200 ug
Please enquire.