Human PLA2G10(Phospholipase A2, Group X) ELISA Kit
To Order Contact us: michael@lotusbiotechnologies.com
Phospholipase A2, Group X (PLA2G10) Antibody |
20-abx128169 |
Abbexa |
-
EUR 425.00
-
EUR 133.00
-
EUR 1205.00
-
EUR 578.00
-
EUR 328.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
|
Phospholipase A2, Group X (PLA2G10) Antibody |
20-abx174048 |
Abbexa |
|
|
|
Phospholipase A2, Group X (PLA2G10) Antibody |
20-abx301835 |
Abbexa |
-
EUR 411.00
-
EUR 1845.00
-
EUR 599.00
-
EUR 182.00
-
EUR 300.00
|
-
100 ug
-
1 mg
-
200 ug
-
20 ug
-
50 ug
|
|
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
SED833Hu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4731.5 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids. |
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
SED833Hu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 477.3 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids. |
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
SED833Hu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 639 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids. |
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
SED833Hu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2575.5 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids. |
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
4-SED833Hu |
Cloud-Clone |
-
EUR 4782.00
-
EUR 2526.00
-
EUR 640.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group X (PLA2G10) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species. |
Human Phospholipase A2, Group X (PLA2G10)ELISA kit |
201-12-2526 |
SunredBio |
96 tests |
EUR 440 |
|
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
20-abx152758 |
Abbexa |
-
EUR 7378.00
-
EUR 3933.00
-
EUR 911.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
abx252990-96tests |
Abbexa |
96 tests |
EUR 668 |
|
Human PLA2G10(Phospholipase A2, Group X) ELISA Kit |
EH3603 |
FN Test |
96T |
EUR 524.1 |
|
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 4.688pg/ml |
Human Phospholipase A2, Group X (PLA2G10) Protein |
20-abx167064 |
Abbexa |
-
EUR 704.00
-
EUR 286.00
-
EUR 2165.00
-
EUR 829.00
-
EUR 495.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
|
Monkey Phospholipase A2, Group X (PLA2G10) ELISA Kit |
abx360270-96tests |
Abbexa |
96 tests |
EUR 825 |
|
Pig Phospholipase A2, Group X (PLA2G10) ELISA Kit |
abx362012-96tests |
Abbexa |
96 tests |
EUR 825 |
|
Rabbit Phospholipase A2, Group X (PLA2G10) ELISA Kit |
abx362347-96tests |
Abbexa |
96 tests |
EUR 825 |
|
Chicken Phospholipase A2, Group X (PLA2G10) ELISA Kit |
abx356098-96tests |
Abbexa |
96 tests |
EUR 825 |
|
Human Phospholipase A2, Group X (PLA2G10) CLIA Kit |
20-abx494408 |
Abbexa |
-
EUR 7973.00
-
EUR 4246.00
-
EUR 981.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
Human Phospholipase A2, Group X (PLA2G10) CLIA Kit |
abx197460-96tests |
Abbexa |
96 tests |
EUR 825 |
|
ELISA kit for Human PLA2G10 (Phospholipase A2, Group X) |
E-EL-H1011 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 534 |
|
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G10 (Phospholipase A2, Group X) in samples from Serum, Plasma, Cell supernatant |
ELISA kit for Human PLA2G10 (Phospholipase A2, Group X) |
ELK4236 |
ELK Biotech |
1 plate of 96 wells |
EUR 432 |
|
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group X from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
Phospholipase A2, Group X (PLA2G10) Antibody (HRP) |
20-abx315919 |
Abbexa |
-
EUR 411.00
-
EUR 1845.00
-
EUR 599.00
-
EUR 182.00
-
EUR 300.00
|
-
100 ug
-
1 mg
-
200 ug
-
20 ug
-
50 ug
|
|
Phospholipase A2, Group X (PLA2G10) Antibody (FITC) |
20-abx315920 |
Abbexa |
-
EUR 411.00
-
EUR 1845.00
-
EUR 599.00
-
EUR 182.00
-
EUR 300.00
|
-
100 ug
-
1 mg
-
200 ug
-
20 ug
-
50 ug
|
|
Phospholipase A2, Group X (PLA2G10) Antibody (Biotin) |
20-abx315921 |
Abbexa |
-
EUR 411.00
-
EUR 1845.00
-
EUR 599.00
-
EUR 182.00
-
EUR 300.00
|
-
100 ug
-
1 mg
-
200 ug
-
20 ug
-
50 ug
|
|
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human) |
4-PAD833Hu01 |
Cloud-Clone |
-
EUR 247.00
-
EUR 2510.00
-
EUR 625.00
-
EUR 310.00
-
EUR 214.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10) |
CLIA kit for Human PLA2G10 (Phospholipase A2, Group X) |
E-CL-H0681 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 584 |
|
Description: A sandwich CLIA kit for quantitative measurement of Human PLA2G10 (Phospholipase A2, Group X) in samples from Serum, Plasma, Cell supernatant |
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), APC |
4-PAD833Hu01-APC |
Cloud-Clone |
-
EUR 345.00
-
EUR 3275.00
-
EUR 912.00
-
EUR 440.00
-
EUR 219.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with APC. |
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), Biotinylated |
4-PAD833Hu01-Biotin |
Cloud-Clone |
-
EUR 311.00
-
EUR 2460.00
-
EUR 727.00
-
EUR 381.00
-
EUR 219.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with Biotin. |
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), Cy3 |
4-PAD833Hu01-Cy3 |
Cloud-Clone |
-
EUR 419.00
-
EUR 4325.00
-
EUR 1175.00
-
EUR 545.00
-
EUR 251.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with Cy3. |
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), FITC |
4-PAD833Hu01-FITC |
Cloud-Clone |
-
EUR 296.00
-
EUR 2640.00
-
EUR 750.00
-
EUR 372.00
-
EUR 195.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with FITC. |
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), HRP |
4-PAD833Hu01-HRP |
Cloud-Clone |
-
EUR 316.00
-
EUR 2855.00
-
EUR 807.00
-
EUR 398.00
-
EUR 206.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with HRP. |
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), PE |
4-PAD833Hu01-PE |
Cloud-Clone |
-
EUR 296.00
-
EUR 2640.00
-
EUR 750.00
-
EUR 372.00
-
EUR 195.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with PE. |
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), APC-Cy7 |
4-PAD833Hu01-APC-Cy7 |
Cloud-Clone |
-
EUR 571.00
-
EUR 6430.00
-
EUR 1705.00
-
EUR 760.00
-
EUR 319.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with APC-Cy7. |
Human Group 10 secretory phospholipase A2(PLA2G10) ELISA kit |
CSB-EL018085HU-24T |
Cusabio |
1 plate of 24 wells |
EUR 165 |
|
Description: Quantitativesandwich ELISA kit for measuring Human Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Human Group 10 secretory phospholipase A2(PLA2G10) ELISA kit |
1-CSB-EL018085HU |
Cusabio |
-
EUR 804.00
-
EUR 5099.00
-
EUR 2704.00
|
-
1 plate of 96 wells
-
10 plates of 96 wells each
-
5 plates of 96 wells each
|
|
Description: Quantitativesandwich ELISA kit for measuring Human Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Human Group 10 secretory phospholipase A2, PLA2G10 ELISA KIT |
ELI-37033h |
Lifescience Market |
96 Tests |
EUR 824 |
Mouse Group 10 secretory phospholipase A2(PLA2G10) ELISA kit |
CSB-EL018085MO-24T |
Cusabio |
1 plate of 24 wells |
EUR 165 |
|
Description: Quantitativesandwich ELISA kit for measuring Mouse Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Mouse Group 10 secretory phospholipase A2(PLA2G10) ELISA kit |
1-CSB-EL018085MO |
Cusabio |
-
EUR 804.00
-
EUR 5099.00
-
EUR 2704.00
|
-
1 plate of 96 wells
-
10 plates of 96 wells each
-
5 plates of 96 wells each
|
|
Description: Quantitativesandwich ELISA kit for measuring Mouse Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Rat Group 10 secretory phospholipase A2(PLA2G10) ELISA kit |
CSB-EL018085RA-24T |
Cusabio |
1 plate of 24 wells |
EUR 165 |
|
Description: Quantitativesandwich ELISA kit for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Rat Group 10 secretory phospholipase A2(PLA2G10) ELISA kit |
1-CSB-EL018085RA |
Cusabio |
-
EUR 804.00
-
EUR 5099.00
-
EUR 2704.00
|
-
1 plate of 96 wells
-
10 plates of 96 wells each
-
5 plates of 96 wells each
|
|
Description: Quantitativesandwich ELISA kit for measuring Rat Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Mouse Group 10 secretory phospholipase A2, Pla2g10 ELISA KIT |
ELI-16162m |
Lifescience Market |
96 Tests |
EUR 865 |
PLA2G10 Secreted Phospholipase A2-X Human Recombinant Protein |
PROTO15496 |
BosterBio |
Regular: 10ug |
EUR 317 |
Description: Secreted Phospholipase A2-X Human Recombinant is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag (underlined).;MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQ;PRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQE;LLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD. |
ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10) |
KTE100470-96T |
Abbkine |
96T |
EUR 539 |
|
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10) |
KTE100470-48T |
Abbkine |
48T |
EUR 332 |
|
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10) |
KTE100470-5platesof96wells |
Abbkine |
5 plates of 96 wells |
EUR 2115 |
|
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
SEB077Hu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4502.43 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
SEB077Hu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 458.44 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
SEB077Hu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 612.05 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
SEB077Hu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2454.23 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
4-SEB077Hu |
Cloud-Clone |
-
EUR 4553.00
-
EUR 2405.00
-
EUR 613.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species. |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
SED827Hu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4731.5 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
SED827Hu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 477.3 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
SED827Hu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 639 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
SED827Hu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2575.5 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
4-SED827Hu |
Cloud-Clone |
-
EUR 4782.00
-
EUR 2526.00
-
EUR 640.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species. |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
SED832Hu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4731.5 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
SED832Hu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 477.3 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
SED832Hu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 639 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
SED832Hu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2575.5 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
4-SED832Hu |
Cloud-Clone |
-
EUR 4782.00
-
EUR 2526.00
-
EUR 640.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species. |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
SEM563Hu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 5189.65 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
SEM563Hu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 515.03 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
SEM563Hu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 692.9 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
SEM563Hu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2818.05 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
4-SEM563Hu |
Cloud-Clone |
-
EUR 5240.00
-
EUR 2769.00
-
EUR 693.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species. |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
SEN729Hu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 5189.65 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
SEN729Hu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 515.03 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
SEN729Hu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 692.9 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
SEN729Hu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2818.05 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
4-SEN729Hu |
Cloud-Clone |
-
EUR 5240.00
-
EUR 2769.00
-
EUR 693.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from Serum, plasma, tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species. |
Human Phospholipase A2, Group IID ELISA Kit (PLA2G2D) |
RK02096 |
Abclonal |
96 Tests |
EUR 521 |
Human Phospholipase A2, Group IIA ELISA Kit (PLA2G2A) |
RK02095 |
Abclonal |
96 Tests |
EUR 521 |
Human Phospholipase A2, Group V ELISA Kit (PLA2G5) |
RK02097 |
Abclonal |
96 Tests |
EUR 521 |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
RD-PLA2G12B-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 563 |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
RD-PLA2G12B-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 783 |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
RD-PLA2G2A-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 521 |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
RD-PLA2G2A-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 723 |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
RD-PLA2G2D-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 500 |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
RD-PLA2G2D-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 692 |
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit |
RD-PLA2G3-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 521 |
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit |
RD-PLA2G3-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 723 |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
RD-PLA2G4D-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 563 |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
RD-PLA2G4D-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 783 |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
RD-PLA2G5-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 521 |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
RD-PLA2G5-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 723 |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
DLR-PLA2G12B-Hu-48T |
DL Develop |
48T |
EUR 554 |
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
DLR-PLA2G12B-Hu-96T |
DL Develop |
96T |
EUR 725 |
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
DLR-PLA2G2A-Hu-48T |
DL Develop |
48T |
EUR 517 |
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
DLR-PLA2G2A-Hu-96T |
DL Develop |
96T |
EUR 673 |
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
DLR-PLA2G2D-Hu-48T |
DL Develop |
48T |
EUR 498 |
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
DLR-PLA2G2D-Hu-96T |
DL Develop |
96T |
EUR 647 |
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids. |