Human PLA2G10(Phospholipase A2, Group X) ELISA Kit
To Order Contact us: michael@lotusbiotechnologies.com
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
|||
| 20-abx152758 | Abbexa |
|
|
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
|||
| abx252990-96tests | Abbexa | 96 tests | 801.6 EUR |
Human Phospholipase A2, Group X(PLA2G10)ELISA Kit |
|||
| QY-E05176 | Qayee Biotechnology | 96T | 433.2 EUR |
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
|||
| SED833Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | 5677.8 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids. |
|||
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
|||
| SED833Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | 572.76 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids. |
|||
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
|||
| SED833Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | 766.8 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids. |
|||
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
|||
| SED833Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | 3090.6 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids. |
|||
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
|||
| 4-SED833Hu | Cloud-Clone |
|
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group X (PLA2G10) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species. |
|||
Phospholipase A2, Group X (PLA2G10) Antibody |
|||
| 20-abx174048 | Abbexa |
|
|
Phospholipase A2, Group X (PLA2G10) Antibody |
|||
| 20-abx126373 | Abbexa |
|
|
Phospholipase A2, Group X (PLA2G10) Antibody |
|||
| 20-abx128169 | Abbexa |
|
|
Phospholipase A2, Group X (PLA2G10) Antibody |
|||
| 20-abx301835 | Abbexa |
|
|
Recombinant Phospholipase A2, Group X (PLA2G10) |
|||
| 4-RPD833Hu01 | Cloud-Clone |
|
|
|
Description: Recombinant Human Phospholipase A2, Group X expressed in: E.coli |
|||
Human Phospholipase A2, Group X (PLA2G10) Protein |
|||
| 20-abx167064 | Abbexa |
|
|
Chicken Phospholipase A2, Group X (PLA2G10) ELISA Kit |
|||
| abx356098-96tests | Abbexa | 96 tests | 990 EUR |
Pig Phospholipase A2, Group X (PLA2G10) ELISA Kit |
|||
| abx362012-96tests | Abbexa | 96 tests | 990 EUR |
Rabbit Phospholipase A2, Group X (PLA2G10) ELISA Kit |
|||
| abx362347-96tests | Abbexa | 96 tests | 990 EUR |
Monkey Phospholipase A2, Group X (PLA2G10) ELISA Kit |
|||
| abx360270-96tests | Abbexa | 96 tests | 990 EUR |
Human Phospholipase A2, Group X (PLA2G10) CLIA Kit |
|||
| abx197460-96tests | Abbexa | 96 tests | 990 EUR |
Human Phospholipase A2, Group X (PLA2G10) CLIA Kit |
|||
| 20-abx494408 | Abbexa |
|
|
ELISA kit for Human PLA2G10 (Phospholipase A2, Group X) |
|||
| E-EL-H1011 | Elabscience Biotech | 1 plate of 96 wells | 640.8 EUR |
|
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G10 (Phospholipase A2, Group X) in samples from Serum, Plasma, Cell supernatant |
|||
ELISA kit for Human PLA2G10 (Phospholipase A2, Group X) |
|||
| ELK4236 | ELK Biotech | 1 plate of 96 wells | 518.4 EUR |
|
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group X from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
|||
Phospholipase A2, Group X (PLA2G10) Antibody (HRP) |
|||
| 20-abx315919 | Abbexa |
|
|
Phospholipase A2, Group X (PLA2G10) Antibody (FITC) |
|||
| 20-abx315920 | Abbexa |
|
|
Phospholipase A2, Group X (PLA2G10) Antibody (Biotin) |
|||
| 20-abx315921 | Abbexa |
|
|
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human) |
|||
| 4-PAD833Hu01 | Cloud-Clone |
|
|
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10) |
|||
CLIA kit for Human PLA2G10 (Phospholipase A2, Group X) |
|||
| E-CL-H0681 | Elabscience Biotech | 1 plate of 96 wells | 700.8 EUR |
|
Description: A sandwich CLIA kit for quantitative measurement of Human PLA2G10 (Phospholipase A2, Group X) in samples from Serum, Plasma, Cell supernatant |
|||
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), APC |
|||
| 4-PAD833Hu01-APC | Cloud-Clone |
|
|
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with APC. |
|||
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), Biotinylated |
|||
| 4-PAD833Hu01-Biotin | Cloud-Clone |
|
|
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with Biotin. |
|||
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), Cy3 |
|||
| 4-PAD833Hu01-Cy3 | Cloud-Clone |
|
|
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with Cy3. |
|||
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), FITC |
|||
| 4-PAD833Hu01-FITC | Cloud-Clone |
|
|
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with FITC. |
|||
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), HRP |
|||
| 4-PAD833Hu01-HRP | Cloud-Clone |
|
|
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with HRP. |
|||
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), PE |
|||
| 4-PAD833Hu01-PE | Cloud-Clone |
|
|
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with PE. |
|||
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), APC-Cy7 |
|||
| 4-PAD833Hu01-APC-Cy7 | Cloud-Clone |
|
|
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with APC-Cy7. |
|||
Human Group 10 secretory phospholipase A2(PLA2G10) ELISA kit |
|||
| CSB-EL018085HU-24T | Cusabio | 1 plate of 24 wells | 198 EUR |
|
Description: Quantitativesandwich ELISA kit for measuring Human Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
|||
Human Group 10 secretory phospholipase A2(PLA2G10) ELISA kit |
|||
| 1-CSB-EL018085HU | Cusabio |
|
|
|
Description: Quantitativesandwich ELISA kit for measuring Human Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
|||
Human Group 10 secretory phospholipase A2, PLA2G10 ELISA KIT |
|||
| ELI-37033h | Lifescience Market | 96 Tests | 988.8 EUR |
Mouse Group 10 secretory phospholipase A2(PLA2G10) ELISA kit |
|||
| CSB-EL018085MO-24T | Cusabio | 1 plate of 24 wells | 198 EUR |
|
Description: Quantitativesandwich ELISA kit for measuring Mouse Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
|||
Mouse Group 10 secretory phospholipase A2(PLA2G10) ELISA kit |
|||
| 1-CSB-EL018085MO | Cusabio |
|
|
|
Description: Quantitativesandwich ELISA kit for measuring Mouse Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
|||
Rat Group 10 secretory phospholipase A2(PLA2G10) ELISA kit |
|||
| CSB-EL018085RA-24T | Cusabio | 1 plate of 24 wells | 198 EUR |
|
Description: Quantitativesandwich ELISA kit for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
|||
Rat Group 10 secretory phospholipase A2(PLA2G10) ELISA kit |
|||
| 1-CSB-EL018085RA | Cusabio |
|
|
|
Description: Quantitativesandwich ELISA kit for measuring Rat Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
|||
Mouse Group 10 secretory phospholipase A2, Pla2g10 ELISA KIT |
|||
| ELI-16162m | Lifescience Market | 96 Tests | 1038 EUR |
PLA2G10 Secreted Phospholipase A2-X Human Recombinant Protein |
|||
| PROTO15496 | BosterBio | Regular: 10ug | 380.4 EUR |
|
Description: Secreted Phospholipase A2-X Human Recombinant is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag (underlined).;MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQ;PRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQE;LLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD. |
|||
ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10) |
|||
| KTE100470-48T | Abbkine | 48T | 398.4 EUR |
|
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
|||
ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10) |
|||
| KTE100470-5platesof96wells | Abbkine | 5 plates of 96 wells | 2538 EUR |
|
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
|||
ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10) |
|||
| KTE100470-96T | Abbkine | 96T | 646.8 EUR |
|
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
|||
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
|||
| DLR-PLA2G12B-Hu-48T | DL Develop | 48T | 664.8 EUR |
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from serum, plasma, tissue homogenates or other biological fluids. |
|||
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
|||
| DLR-PLA2G12B-Hu-96T | DL Develop | 96T | 870 EUR |
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from serum, plasma, tissue homogenates or other biological fluids. |
|||
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| DLR-PLA2G2A-Hu-48T | DL Develop | 48T | 620.4 EUR |
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids. |
|||
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| DLR-PLA2G2A-Hu-96T | DL Develop | 96T | 807.6 EUR |
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids. |
|||
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| DLR-PLA2G2D-Hu-48T | DL Develop | 48T | 597.6 EUR |
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids. |
|||
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| DLR-PLA2G2D-Hu-96T | DL Develop | 96T | 776.4 EUR |
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids. |
|||
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit |
|||
| DLR-PLA2G3-Hu-48T | DL Develop | 48T | 620.4 EUR |
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids. |
|||
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit |
|||
| DLR-PLA2G3-Hu-96T | DL Develop | 96T | 807.6 EUR |
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids. |
|||
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
|||
| DLR-PLA2G4D-Hu-48T | DL Develop | 48T | 664.8 EUR |
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from tissue homogenates or other biological fluids. |
|||
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
|||
| DLR-PLA2G4D-Hu-96T | DL Develop | 96T | 870 EUR |
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from tissue homogenates or other biological fluids. |
|||
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
|||
| DLR-PLA2G5-Hu-48T | DL Develop | 48T | 620.4 EUR |
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates or other biological fluids. |
|||
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
|||
| DLR-PLA2G5-Hu-96T | DL Develop | 96T | 807.6 EUR |
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates or other biological fluids. |
|||
Human Phospholipase A2, Group IID (PLA2G2D)ELISA kit |
|||
| 201-12-2525 | SunredBio | 96 tests | 528 EUR |
|
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
|||
Human Phospholipase A2, Group IIA (PLA2G2A)ELISA kit |
|||
| 201-12-2527 | SunredBio | 96 tests | 528 EUR |
|
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
|||
Human Phospholipase A2, Group IVD (PLA2G4D)ELISA kit |
|||
| 201-12-2529 | SunredBio | 96 tests | 528 EUR |
|
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
|||
Human Phospholipase A2, Group XIIB (PLA2G12B)ELISA kit |
|||
| 201-12-2530 | SunredBio | 96 tests | 528 EUR |
|
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
|||
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
|||
| 20-abx152759 | Abbexa |
|
|
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| 20-abx152760 | Abbexa |
|
|
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| 20-abx152761 | Abbexa |
|
|
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
|||
| 20-abx152762 | Abbexa |
|
|
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
|||
| 20-abx152763 | Abbexa |
|
|
Human Group IIA phospholipase A2 (PLA2G2A) ELISA Kit |
|||
| abx575929-96tests | Abbexa | 96 tests | 886.8 EUR |
Human Phospholipase A2 Group VI (PLA2G6) ELISA Kit |
|||
| abx253845-96tests | Abbexa | 96 tests | 801.6 EUR |
Human Group XVI phospholipase A2, PLA2G16 ELISA KIT |
|||
| ELI-45167h | Lifescience Market | 96 Tests | 988.8 EUR |
Human Group XV phospholipase A2, PLA2G15 ELISA KIT |
|||
| ELI-21820h | Lifescience Market | 96 Tests | 988.8 EUR |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
|||
| RD-PLA2G12B-Hu-48Tests | Reddot Biotech | 48 Tests | 675.6 EUR |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
|||
| RD-PLA2G12B-Hu-96Tests | Reddot Biotech | 96 Tests | 939.6 EUR |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| RD-PLA2G2A-Hu-48Tests | Reddot Biotech | 48 Tests | 625.2 EUR |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| RD-PLA2G2A-Hu-96Tests | Reddot Biotech | 96 Tests | 867.6 EUR |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| RD-PLA2G2D-Hu-48Tests | Reddot Biotech | 48 Tests | 600 EUR |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| RD-PLA2G2D-Hu-96Tests | Reddot Biotech | 96 Tests | 830.4 EUR |
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit |
|||
| RD-PLA2G3-Hu-48Tests | Reddot Biotech | 48 Tests | 625.2 EUR |
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit |
|||
| RD-PLA2G3-Hu-96Tests | Reddot Biotech | 96 Tests | 867.6 EUR |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
|||
| RD-PLA2G4D-Hu-48Tests | Reddot Biotech | 48 Tests | 675.6 EUR |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
|||
| RD-PLA2G4D-Hu-96Tests | Reddot Biotech | 96 Tests | 939.6 EUR |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
|||
| RD-PLA2G5-Hu-48Tests | Reddot Biotech | 48 Tests | 625.2 EUR |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
|||
| RD-PLA2G5-Hu-96Tests | Reddot Biotech | 96 Tests | 867.6 EUR |
Human Phospholipase A2, Group XIIB(PLA2G12B)ELISA Kit |
|||
| QY-E05175 | Qayee Biotechnology | 96T | 433.2 EUR |
Human Phospholipase A2, Group IVD(PLA2G4D)ELISA Kit |
|||
| QY-E05205 | Qayee Biotechnology | 96T | 433.2 EUR |
Human Phospholipase A2, Group IID(PLA2G2D)ELISA Kit |
|||
| QY-E05226 | Qayee Biotechnology | 96T | 433.2 EUR |
Human Phospholipase A2, Group IIA(PLA2G2A)ELISA Kit |
|||
| QY-E05227 | Qayee Biotechnology | 96T | 433.2 EUR |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
|||
| RDR-PLA2G12B-Hu-48Tests | Reddot Biotech | 48 Tests | 706.8 EUR |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
|||
| RDR-PLA2G12B-Hu-96Tests | Reddot Biotech | 96 Tests | 984 EUR |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| RDR-PLA2G2A-Hu-48Tests | Reddot Biotech | 48 Tests | 652.8 EUR |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| RDR-PLA2G2A-Hu-96Tests | Reddot Biotech | 96 Tests | 907.2 EUR |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| RDR-PLA2G2D-Hu-48Tests | Reddot Biotech | 48 Tests | 626.4 EUR |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| RDR-PLA2G2D-Hu-96Tests | Reddot Biotech | 96 Tests | 868.8 EUR |
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit |
|||
| RDR-PLA2G3-Hu-48Tests | Reddot Biotech | 48 Tests | 652.8 EUR |
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit |
|||
| RDR-PLA2G3-Hu-96Tests | Reddot Biotech | 96 Tests | 907.2 EUR |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
|||
| RDR-PLA2G4D-Hu-48Tests | Reddot Biotech | 48 Tests | 706.8 EUR |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
|||
| RDR-PLA2G4D-Hu-96Tests | Reddot Biotech | 96 Tests | 984 EUR |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
|||
| RDR-PLA2G5-Hu-48Tests | Reddot Biotech | 48 Tests | 652.8 EUR |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
|||
| RDR-PLA2G5-Hu-96Tests | Reddot Biotech | 96 Tests | 907.2 EUR |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| SEB077Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | 5402.92 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| SEB077Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | 550.13 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| SEB077Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | 734.46 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| SEB077Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | 2945.08 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| 4-SEB077Hu | Cloud-Clone |
|
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species. |
|||
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| SED827Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | 5677.8 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| SED827Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | 572.76 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| SED827Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | 766.8 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| SED827Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | 3090.6 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| 4-SED827Hu | Cloud-Clone |
|
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species. |
|||
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
|||
| SED832Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | 5677.8 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
|||
| SED832Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | 572.76 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
|||
| SED832Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | 766.8 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
|||
| SED832Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | 3090.6 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
|||
| 4-SED832Hu | Cloud-Clone |
|
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species. |
|||
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
|||
| SEM563Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | 6227.58 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids. |
|||
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
|||
| SEM563Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | 618.04 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids. |
|||
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
|||
| SEM563Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | 831.48 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids. |
|||
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
|||
| SEM563Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | 3381.66 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids. |
|||
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
|||
| 4-SEM563Hu | Cloud-Clone |
|
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species. |
|||
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
|||
| SEN729Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | 6227.58 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
|||
| SEN729Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | 618.04 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
|||
| SEN729Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | 831.48 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
|||
| SEN729Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | 3381.66 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
|||
| 4-SEN729Hu | Cloud-Clone |
|
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from Serum, plasma, tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species. |
|||
Human Phospholipase A2, Group IIA ELISA Kit (PLA2G2A) |
|||
| RK02095 | Abclonal | 96 Tests | 625.2 EUR |
Human Phospholipase A2, Group IID ELISA Kit (PLA2G2D) |
|||
| RK02096 | Abclonal | 96 Tests | 625.2 EUR |
Human Phospholipase A2, Group V ELISA Kit (PLA2G5) |
|||
| RK02097 | Abclonal | 96 Tests | 625.2 EUR |
Phospholipase A2, Group Ive Antibody |
|||
| 20-abx114482 | Abbexa |
|
|
Phospholipase A2, Group Ivf Antibody |
|||
| 20-abx114483 | Abbexa |
|
|
Phospholipase A2, Group Xiia Antibody |
|||
| 20-abx114484 | Abbexa |
|
|
Phospholipase A2, Group Xiib Antibody |
|||
| 20-abx114485 | Abbexa |
|
|
Recombinant Human Secreted Phospholipase A2-X |
|||
| 7-03355 | CHI Scientific | 2µg | Ask for price |
Recombinant Human Secreted Phospholipase A2-X |
|||
| 7-03356 | CHI Scientific | 10µg | Ask for price |
Recombinant Human Secreted Phospholipase A2-X |
|||
| 7-03357 | CHI Scientific | 1mg | Ask for price |
ELISA kit for Human PLA2G12B (Phospholipase A2, Group ? B) |
|||
| E-EL-H1029 | Elabscience Biotech | 1 plate of 96 wells | 640.8 EUR |
|
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G12B (Phospholipase A2, Group ? B) in samples from Serum, Plasma, Cell supernatant |
|||
ELISA kit for Human PLA2G4D (Phospholipase A2, Group ? D) |
|||
| E-EL-H1048 | Elabscience Biotech | 1 plate of 96 wells | 640.8 EUR |
|
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G4D (Phospholipase A2, Group ? D) in samples from Serum, Plasma, Cell supernatant |
|||
ELISA kit for Human PLA2G2D (Phospholipase A2, Group ?D) |
|||
| E-EL-H2384 | Elabscience Biotech | 1 plate of 96 wells | 640.8 EUR |
|
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G2D (Phospholipase A2, Group ?D) in samples from Serum, Plasma, Cell supernatant |
|||
ELISA kit for Human PLA2G2A (Phospholipase A2, Group ?A) |
|||
| E-EL-H2385 | Elabscience Biotech | 1 plate of 96 wells | 640.8 EUR |
|
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G2A (Phospholipase A2, Group ?A) in samples from Serum, Plasma, Cell supernatant |
|||
Human Group XIIA secretory phospholipase A2(PLA2G12A) ELISA kit |
|||
| CSB-EL018086HU-24T | Cusabio | 1 plate of 24 wells | 198 EUR |
|
Description: Quantitativecompetitive ELISA kit for measuring Human Group XIIA secretory phospholipase A2 (PLA2G12A) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
|||
Human Group XIIA secretory phospholipase A2(PLA2G12A) ELISA kit |
|||
| 1-CSB-EL018086HU | Cusabio |
|
|
|
Description: Quantitativecompetitive ELISA kit for measuring Human Group XIIA secretory phospholipase A2(PLA2G12A) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
|||
Human Group IIF secretory phospholipase A2(PLA2G2F) ELISA kit |
|||
| CSB-EL018095HU-24T | Cusabio | 1 plate of 24 wells | 198 EUR |
|
Description: Quantitativesandwich ELISA kit for measuring Human Group IIF secretory phospholipase A2 (PLA2G2F) in samples from serum, plasma, tissue, homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
|||
Human Group IIF secretory phospholipase A2(PLA2G2F) ELISA kit |
|||
| 1-CSB-EL018095HU | Cusabio |
|
|
|
Description: Quantitativesandwich ELISA kit for measuring Human Group IIF secretory phospholipase A2(PLA2G2F) in samples from serum, plasma, tissue, homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
|||
ELISA kit for Human PLA2G2D (Phospholipase A2, Group IID) |
|||
| ELK1754 | ELK Biotech | 1 plate of 96 wells | 518.4 EUR |
|
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group IID from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
|||
ELISA kit for Human PLA2G2A (Phospholipase A2, Group IIA) |
|||
| ELK3752 | ELK Biotech | 1 plate of 96 wells | 518.4 EUR |
|
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group IIA from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
|||
ELISA kit for Human PLA2G12B (Phospholipase A2, Group XIIB) |
|||
| ELK6117 | ELK Biotech | 1 plate of 96 wells | 518.4 EUR |
|
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group XIIB from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
|||
ELISA kit for Human PLA2G4D (Phospholipase A2, Group IVD) |
|||
| ELK6188 | ELK Biotech | 1 plate of 96 wells | 518.4 EUR |
|
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group IVD from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
|||
Human PLA2G12B(Phospholipase A2, Group XII B) ELISA Kit |
|||
| EH3604 | FN Test | 96T | 628.92 EUR |
|
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.094 ng/ml |
|||
Human PLA2G4D(Phospholipase A2, Group IV D) ELISA Kit |
|||
| EH3606 | FN Test | 96T | 628.92 EUR |
|
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.094 ng/ml |
|||
ELISA kit for Human PLA2G5 (Phospholipase A2, Group V) |
|||
| ELK4777 | ELK Biotech | 1 plate of 96 wells | 518.4 EUR |
|
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group V from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
|||
Human Phospholipase A2 Group XII A (PLA2G12A) ELISA Kit |
|||
| abx382266-96tests | Abbexa | 96 tests | 1093.2 EUR |
Human Phospholipase A2 Group IV B (PLA2G4B) ELISA Kit |
|||
| abx382267-96tests | Abbexa | 96 tests | 1093.2 EUR |
Human Phospholipase A2 Group IV E (PLA2G4E) ELISA Kit |
|||
| abx382268-96tests | Abbexa | 96 tests | 1093.2 EUR |
Human Phospholipase A2 Group IV F (PLA2G4E) ELISA Kit |
|||
| 20-abx382269 | Abbexa |
|
|
Human Phospholipase A2, Group II D (PLA2G2D) ELISA Kit |
|||
| abx354458-96tests | Abbexa | 96 tests | 848.4 EUR |
Human Phospholipase A2, Group II A (PLA2G2A) ELISA Kit |
|||
| abx251779-96tests | Abbexa | 96 tests | 904.8 EUR |
Human Phospholipase A2, Group XII B (PLA2G12B) ELISA Kit |
|||
| abx252991-96tests | Abbexa | 96 tests | 848.4 EUR |
Human Phospholipase A2, Group IV D (PLA2G4D) ELISA Kit |
|||
| abx252993-96tests | Abbexa | 96 tests | 848.4 EUR |
Human Group IID secretory phospholipase A2, PLA2G2D ELISA KIT |
|||
| ELI-45186h | Lifescience Market | 96 Tests | 988.8 EUR |
Human Group IIE secretory phospholipase A2, PLA2G2E ELISA KIT |
|||
| ELI-35519h | Lifescience Market | 96 Tests | 988.8 EUR |
Human Group 3 secretory phospholipase A2, PLA2G3 ELISA KIT |
|||
| ELI-37656h | Lifescience Market | 96 Tests | 988.8 EUR |
Human Group IIF secretory phospholipase A2, PLA2G2F ELISA KIT |
|||
| ELI-23295h | Lifescience Market | 96 Tests | 988.8 EUR |
Human Group XIIA secretory phospholipase A2, PLA2G12A ELISA KIT |
|||
| ELI-21567h | Lifescience Market | 96 Tests | 988.8 EUR |
Secreted Phospholipase A2-X (Recombinant) |
|||
| 20-abx073638 | Abbexa |
|
|
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| DLR-PLA2G2A-Mu-48T | DL Develop | 48T | 632.4 EUR |
|
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids. |
|||
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| DLR-PLA2G2A-Mu-96T | DL Develop | 96T | 825.6 EUR |
|
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids. |
|||
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| DLR-PLA2G2A-Ra-48T | DL Develop | 48T | 658.8 EUR |
|
Description: A sandwich quantitative ELISA assay kit for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids. |
|||
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| DLR-PLA2G2A-Ra-96T | DL Develop | 96T | 861.6 EUR |
|
Description: A sandwich quantitative ELISA assay kit for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids. |
|||
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| DLR-PLA2G2D-Mu-48T | DL Develop | 48T | 609.6 EUR |
|
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids. |
|||
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| DLR-PLA2G2D-Mu-96T | DL Develop | 96T | 793.2 EUR |
|
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids. |
|||
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit |
|||
| DLR-PLA2G3-Mu-48T | DL Develop | 48T | 632.4 EUR |
|
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids. |
|||
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit |
|||
| DLR-PLA2G3-Mu-96T | DL Develop | 96T | 825.6 EUR |
|
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids. |
|||
Mouse PLA2G2D(Phospholipase A2, Group IID) ELISA Kit |
|||
| EM1297 | FN Test | 96T | 628.92 EUR |
|
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 18.75pg/ml |
|||
Rat PLA2G2A(Phospholipase A2,Group IIA) ELISA Kit |
|||
| ER1276 | FN Test | 96T | 628.92 EUR |
|
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Rattus;Sensitivity: 0.094 ng/ml |
|||
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| 20-abx154554 | Abbexa |
|
|
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| 20-abx154555 | Abbexa |
|
|
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit |
|||
| 20-abx154556 | Abbexa |
|
|
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| 20-abx155982 | Abbexa |
|
|
Mouse Phospholipase A2 Group VI (PLA2G6) ELISA Kit |
|||
| abx512875-96tests | Abbexa | 96 tests | 801.6 EUR |
Rat Phospholipase A2 Group VI (PLA2G6) ELISA Kit |
|||
| abx512877-96tests | Abbexa | 96 tests | 801.6 EUR |
Rat Group IIA phospholipase A2 (PLA2G2A) ELISA Kit |
|||
| abx572864-96tests | Abbexa | 96 tests | 848.4 EUR |
Mouse Group IIA phospholipase A2 (PLA2G2A) ELISA Kit |
|||
| abx575023-96tests | Abbexa | 96 tests | 886.8 EUR |
Cow Group IIA phospholipase A2 (PLA2G2A) ELISA Kit |
|||
| abx520902-96tests | Abbexa | 96 tests | 1093.2 EUR |
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| abx254356-96tests | Abbexa | 96 tests | 848.4 EUR |
Rat Group IIA phospholipase A2 (PLA2G2A) ELISA Kit |
|||
| abx255942-96tests | Abbexa | 96 tests | 848.4 EUR |
Mouse Group XVI phospholipase A2, Pla2g16 ELISA KIT |
|||
| ELI-37775m | Lifescience Market | 96 Tests | 1038 EUR |
Bovine Group XV phospholipase A2, PLA2G15 ELISA KIT |
|||
| ELI-14523b | Lifescience Market | 96 Tests | 1113.6 EUR |
Mouse Group XV phospholipase A2, Pla2g15 ELISA KIT |
|||
| ELI-14703m | Lifescience Market | 96 Tests | 1038 EUR |
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| RD-PLA2G2A-Mu-48Tests | Reddot Biotech | 48 Tests | 639.6 EUR |
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| RD-PLA2G2A-Mu-96Tests | Reddot Biotech | 96 Tests | 888 EUR |
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| RD-PLA2G2A-Ra-48Tests | Reddot Biotech | 48 Tests | 668.4 EUR |
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| RD-PLA2G2A-Ra-96Tests | Reddot Biotech | 96 Tests | 930 EUR |
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| RD-PLA2G2D-Mu-48Tests | Reddot Biotech | 48 Tests | 613.2 EUR |
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| RD-PLA2G2D-Mu-96Tests | Reddot Biotech | 96 Tests | 850.8 EUR |
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit |
|||
| RD-PLA2G3-Mu-48Tests | Reddot Biotech | 48 Tests | 639.6 EUR |
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit |
|||
| RD-PLA2G3-Mu-96Tests | Reddot Biotech | 96 Tests | 888 EUR |
Rat Phospholipase A2, Group IIA(PLA2G2A)ELISA Kit |
|||
| QY-E10194 | Qayee Biotechnology | 96T | 433.2 EUR |
Rat Phospholipase A2(Group IVD(PLA2G4D)ELISA kit |
|||
| QY-E10542 | Qayee Biotechnology | 96T | 495.6 EUR |
Rat Phospholipase A2(Group IID(PLA2G2D)ELISA kit |
|||
| QY-E10543 | Qayee Biotechnology | 96T | 495.6 EUR |
Mouse Phospholipase A2(Group IID(PLA2G2D)ELISA kit |
|||
| QY-E21172 | Qayee Biotechnology | 96T | 433.2 EUR |
Mouse Phospholipase A2(Group IVD(PLA2G4D)ELISA kit |
|||
| QY-E21173 | Qayee Biotechnology | 96T | 433.2 EUR |
Mouse Phospholipase A2, Group IIA(PLA2G2A)ELISA Kit |
|||
| QY-E21175 | Qayee Biotechnology | 96T | 433.2 EUR |
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| RDR-PLA2G2A-Mu-48Tests | Reddot Biotech | 48 Tests | 668.4 EUR |
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| RDR-PLA2G2A-Mu-96Tests | Reddot Biotech | 96 Tests | 928.8 EUR |
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| RDR-PLA2G2A-Ra-48Tests | Reddot Biotech | 48 Tests | 699.6 EUR |
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| RDR-PLA2G2A-Ra-96Tests | Reddot Biotech | 96 Tests | 973.2 EUR |
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| RDR-PLA2G2D-Mu-48Tests | Reddot Biotech | 48 Tests | 640.8 EUR |
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| RDR-PLA2G2D-Mu-96Tests | Reddot Biotech | 96 Tests | 890.4 EUR |
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit |
|||
| RDR-PLA2G3-Mu-48Tests | Reddot Biotech | 48 Tests | 668.4 EUR |
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit |
|||
| RDR-PLA2G3-Mu-96Tests | Reddot Biotech | 96 Tests | 928.8 EUR |
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| SEB077Mu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | 5552.14 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| SEB077Mu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | 562.42 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| SEB077Mu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | 752.02 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| SEB077Mu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | 3024.07 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Mouse Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
| 4-SEB077Mu | Cloud-Clone |
|
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Phospholipase A2, Group IID (PLA2G2D) in samples from Serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species. |
|||
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| SED827Mu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | 5834.88 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| SED827Mu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | 585.7 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| SED827Mu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | 785.28 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| SED827Mu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | 3173.76 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| 4-SED827Mu | Cloud-Clone |
|
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species. |
|||
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| SED827Ra-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | 6149.04 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| SED827Ra-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | 611.57 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| SED827Ra-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | 822.24 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| SED827Ra-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | 3340.08 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
|||
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
| 4-SED827Ra | Cloud-Clone |
|
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Rat Phospholipase A2, Group IIA (PLA2G2A) in samples from Serum, plasma, tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species. |
|||
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit |
|||
| SED831Mu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | 5834.88 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group III (PLA2G3) in serum, plasma and other biological fluids. |
|||
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit |
|||
| SED831Mu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | 585.7 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group III (PLA2G3) in serum, plasma and other biological fluids. |
|||
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit |
|||
| SED831Mu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | 785.28 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group III (PLA2G3) in serum, plasma and other biological fluids. |
|||
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit |
|||
| SED831Mu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | 3173.76 EUR |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Phospholipase A2, Group III (PLA2G3) in serum, plasma and other biological fluids. |
|||
Mouse Phospholipase A2, Group III (PLA2G3) ELISA Kit |
|||
| 4-SED831Mu | Cloud-Clone |
|
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Phospholipase A2, Group III (PLA2G3) in samples from Serum, plasma and other biological fluids. with no significant corss-reactivity with analogues from other species. |
|||
Human Phospholipase A2, Group IVD (PLA2G4D) CLIA Kit |
|||
| 20-abx496066 | Abbexa |
|
|
Human Phospholipase A2, Group XIIB (PLA2G12B) CLIA Kit |
|||
| 20-abx496107 | Abbexa |
|
|
Human Phospholipase A2, Group IIA (PLA2G2A) CLIA Kit |
|||
| 20-abx494403 | Abbexa |
|
|
Human Phospholipase A2, Group V (PLA2G5) CLIA Kit |
|||
| 20-abx494407 | Abbexa |
|
|
Human Phospholipase A2, Group IID (PLA2G2D) CLIA Kit |
|||
| 20-abx492390 | Abbexa |
|
|
Human Group IID secretory phospholipase A2 (PLA2G2D) |
|||
| 1-CSB-EP891566HU | Cusabio |
|
|
|
Description: Recombinant Human Group IID secretory phospholipase A2(PLA2G2D),partial expressed in E.coli |
|||
Human Group XIIA secretory phospholipase A2 (PLA2G12A) |
|||
| 1-CSB-YP863638HU | Cusabio |
|
|
|
Description: Recombinant Human Group XIIA secretory phospholipase A2(PLA2G12A),partial expressed in Yeast |
|||
Human Phospholipase A2, Group IIA (PLA2G2A) Protein |
|||
| 20-abx166841 | Abbexa |
|
|
Human Phospholipase A2, Group III (PLA2G3) Protein |
|||
| 20-abx650483 | Abbexa |
|
|
Human Phospholipase A2, Group XII (PLA2G12) Protein |
|||
| 20-abx650485 | Abbexa |
|
|
Human Phospholipase A2, Group IVD (PLA2G4D) Protein |
|||
| 20-abx650806 | Abbexa |
|
|
Human Phospholipase A2, Group IID (PLA2G2D) Protein |
|||
| 20-abx654724 | Abbexa |
|
|
Human Phospholipase A2, Group V (PLA2G5) Protein |
|||
| 20-abx654728 | Abbexa |
|
|
Human Phospholipase A2, Group XIIB (PLA2G12B) Protein |
|||
| 20-abx654729 | Abbexa |
|
|
Mouse Group XV phospholipase A2 (Pla2g15) |
|||
| 1-CSB-EP840854MO | Cusabio |
|
|
|
Description: Recombinant Mouse Group XV phospholipase A2 (Pla2g15) expressed in E.coli |
|||
Phospholipase A2, Group IIA (PLA2G2A) Antibody |
|||
| 20-abx103197 | Abbexa |
|
|
Phospholipase A2, Group IID (PLA2G2D) Antibody |
|||
| 20-abx103198 | Abbexa |
|
|
Phospholipase A2, Group IIA (PLA2G2A) Antibody |
|||
| 20-abx174043 | Abbexa |
|
|
Phospholipase A2, Group IIA (PLA2G2A) Antibody |
|||
| 20-abx174044 | Abbexa |
|
|
Phospholipase A2, Group IID (PLA2G2D) Antibody |
|||
| 20-abx174045 | Abbexa |
|
|
Phospholipase A2, Group IVD (PLA2G4D) Antibody |
|||
| 20-abx174046 | Abbexa |
|
|
Phospholipase A2, Group V (PLA2G5) Antibody |
|||
| 20-abx174047 | Abbexa |
|
|
Phospholipase A2, Group XIIB (PLA2G12B) Antibody |
|||
| 20-abx174049 | Abbexa |
|
|
Phospholipase A2 Group VI (PLA2G6) Antibody |
|||
| 20-abx124080 | Abbexa |
|
|
Phospholipase A2 Group IVC (PLA2G4C) Antibody |
|||
| 20-abx134069 | Abbexa |
|
|
Phospholipase A2, Group IID (PLA2G2D) Antibody |
|||
| 20-abx130118 | Abbexa |
|
|
Phospholipase A2, Group IVD (PLA2G4D) Antibody |
|||
| 20-abx130913 | Abbexa |
|
|
Phospholipase A2, Group III (PLA2G3) Antibody |
|||
| 20-abx131085 | Abbexa |
|
|
Phospholipase A2, Group III (PLA2G3) Antibody |
|||
| 20-abx131086 | Abbexa |
|
|
Phospholipase A2, Group XII (PLA2G12) Antibody |
|||
| 20-abx131471 | Abbexa |
|
|
Phospholipase A2, Group XII (PLA2G12) Antibody |
|||
| 20-abx131472 | Abbexa |
|
|
Phospholipase A2, Group IIA (PLA2G2A) Antibody |
|||
| 20-abx128864 | Abbexa |
|
|
Phospholipase A2, Group Ivd (Cytosolic) Antibody |
|||
| 20-abx114481 | Abbexa |
|
|
Phospholipase A2 Group IVC (PLA2G4C) Antibody |
|||
| 20-abx006526 | Abbexa |
|
|
Phospholipase A2 Group IVC (PLA2G4C) Antibody |
|||
| 20-abx014417 | Abbexa |
|
|
Phospholipase A2, Group V (PLA2G5) Antibody |
|||
| abx028287-400ul | Abbexa | 400 ul | 627.6 EUR |
Phospholipase A2, Group V (PLA2G5) Antibody |
|||
| abx028287-80l | Abbexa | 80 µl | 343.2 EUR |
Phospholipase A2, Group III (PLA2G3) Antibody |
|||
| abx030609-400ul | Abbexa | 400 ul | 627.6 EUR |
Phospholipase A2, Group III (PLA2G3) Antibody |
|||
| abx030609-80l | Abbexa | 80 µl | 343.2 EUR |
Phospholipase A2 Group IVC (PLA2G4C) Antibody |
|||
| abx331099-100ul | Abbexa | 100 ul | 510 EUR |
Phospholipase A2 Group IVC (PLA2G4C) Antibody |
|||
| abx433141-200ul | Abbexa | 200 ul | 460.8 EUR |